The GameSpinner class provides methods to spin the spinner, get the current value, and reset it, maintaining an internal state variable to track the value.The implementation adheres to the provided specifications and demonstrates the expected behavior of a game spinner.
How does the GameSpinner class implementation conform to the given specifications and example?The GameSpinner class is a custom implementation that represents a spinner used in a game. The class provides methods to spin the spinner, get the current value, and reset it. The implementation follows the given specifications and conforms to the example provided.
The GameSpinner class maintains an internal state variable to track the current value. The spin() method generates a random number between 1 and the maximum value specified during initialization and updates the state variable accordingly.
The getValue() method returns the current value. The reset() method sets the state variable back to its initial value.
Overall, the implementation of the GameSpinner class adheres to the provided specifications and demonstrates the expected behavior of a game spinner.
Learn more about GameSpinner
brainly.com/question/28053654
#SPJ11
Which properties are characteristic of metalloids?
First to answer right will get brainest
Answer:
Mark other brain Thx
Explanation:
A regular hexagon has a side length of 6k^2 + 8 inches long. What is the perimeter
Find the probability of getting 6 or more girls in 8 births.
Answer:
The probability of getting a girl is 12 . The probability of getting 6 girls is therefore (12)6 . Since we have 6 girls, we also need to find the probability of getting 2 boys, which is (12)2 . There are (86)=28 ways to get 6 girls out of 8 children.
Explanation:
Answer:
Explanation:
P(X > 6) = ?
P(X > 6) = P(X = 6) + P(X = 7) + P(X = 8)
P(X > 6) = 0.118 + 0.035 + 0.004
P(X > 6) = 0.157
Thus the probability of getting 6 or more girls in 8 births is 0.157
The line in the xyxyx, y-plane above represents the relationship between the height h(x)h(x)h, left parenthesis, x, right parenthesis, in feet, and the base diameter xxx, in feet, for cylindrical Doric columns in ancient Greek architecture. How much greater is the height of a Doric column that has a base diameter of 555 feet than the height of a Doric column that has a base diameter of 222 feet?
Answer:
21 feet
Explanation:
The graph shows the column with a diameter of 5 ft will have a height of 35 ft. Similarly, it shows a column with a diameter of 2 ft has a height of 14 ft. The wider column is taller by ...
35 ft -14 ft = 21 ft
Argument Reread page 64. Restate what Beto, Harry, and Gustavo Adolfo each said about which of the children's rights was most important. Whose argument do you agree with? Why?
Beto holds the opinion that the most crucial among children's rights is access to education, as it establishes the groundwork for achievement and prosperity in one's future.
What was Harry's opinion?According to Harry, the ultimate priority is safeguarding the welfare of children, as their ability to prosper is hampered by persistent apprehension.
According to Gustavo Adolfo, the most crucial right among all is the right to health, as it serves as the foundation for enjoying other rights, and children are deprived of their basic rights in its absence.
It is imperative to acknowledge that all of these rights hold equal importance, and none of the rights outweighs the other. Every child has a right to a secure, wholesome, and educated environment that can help them achieve their maximum potential.
Read more about children rights here:
https://brainly.com/question/4468141
#SPJ1
on december 1, 2021, your company borrowed $15,000, a portion of which is to be repaid each year on november 30. specifically, your company will make the following principal payments: 2022, $2,000; 2023, $3,000; 2024, $4,000; and 2025, $6,000. show how this loan will be reported in the december 31, 2022 and 2021, balance sheets, assuming principal payments will be made when required.
The following is how this loan will be reported in Your Company's Balance Sheets:
Your Company
Balance Sheets
As of December 31
2022 2021
Current Liabilities:
Loan Payable $3,000 $2,000
Long-term Liabilities:
Loan Payable $10,000 $13,000
Data and Calculations:
Dec. 1, 2021, Loan = $15,000
Repayment of Loan:
Date Repayment Dec. 31 Balance
Dec. 2021 $0 $15,000
Nov. 2022, $2,000 $13,000
Nov. 2023, $3,000 $10,000
Nov. 2024, $4,000 $6,000
Nov. 2025, $6,000 $0
Thus, the loan payable in 2022 and 2023 will be shown under current liabilities in 2021 and 2022, respectively. The remaining portion will appear under long-term liabilities.
Learn more: https://brainly.com/question/15188565
Since 60° is of 360° then the length of is the circumference of the circle.
Since 60° is one-sixth (1/6) of 360°, then the length of the arc subtended by a central angle of 60° is one-sixth (1/6) of the circumference of the circle.
What equation that passes through a line (1, -1) and (3, 5).
Answer:
so the equation of the line is y = 3x - 1
Explanation:
soln
you find the slopeslope=5- -1
3 - 1
=6
2
slope=3
2. Then you find the equation
y - 5 = 3
x - 2
3. you close multiplication
y - 5 = 3(x - 2)
y - 5 = 3x - 6
4.you correct like terms together
y = 3x - 6 + 5
y = 3x - 1
I love it I love it it is reaally great but I'm being timed so can I please see my answer.
Answer:
wheres the question
Explanation:
In a certain language “SUDAN” is coded as “45” and “ITALY” is coded as “9”. What will be the code for the “EGYPT” in that language?
who will tell in 4 minutes will be marked as brainliest
Answer:
If we consider each letter in the word "SUDAN" and "ITALY" as a digit, where "A" is represented by 1, "B" by 2, and so on, then we can add up the digits in each word to get their respective codes.
For "SUDAN," we have:
S = 19
U = 21
D = 4
A = 1
N = 14
Adding these up, we get:
19 + 21 + 4 + 1 + 14 = 59
So "SUDAN" is coded as "59."
For "ITALY," we have:
I = 9
T = 20
A = 1
L = 12
Y = 25
Adding these up, we get:
9 + 20 + 1 + 12 + 25 = 67
So "ITALY" is coded as "67."
Now, for "EGYPT," we have:
E = 5
G = 7
Y = 25
P = 16
T = 20
Adding these up, we get:
5 + 7 + 25 + 16 + 20 = 73
So "EGYPT" is coded as "73."
what normally falls under general education requirements at a college
Answer:Writing, math/algebra, quantitative and formal reasoning, diversity, language/oral and professional communication, humanities and arts, social sciences, and natural sciences, global awareness and cultural understanding, and electives.
Explanation:
C=5/9 (F−32)
The equation above shows how temperature F, measured in degrees Fahrenheit, relates to a temperature C, measured in degrees Celsius. Based on the equation, which of the following must be true?
A temperature increase of 1 degree Fahrenheit is equivalent to a temperature increase of
5
9
degree Celsius.
A temperature increase of 1 degree Celsius is equivalent to a temperature increase of 1.8 degrees Fahrenheit.
A temperature increase of
5
9
degree Fahrenheit is equivalent to a temperature increase of 1 degree Celsius.
A) I only
B) II only
C) III only
D) I and II only
Answer:
the answer is d
Explanation:
Answer:
I think is c
Explanation:
hope this helps
The University of Florida Honors Program is a "community of scholars" bound together
by a shared interest in maximizing the undergraduate experience. Why are you drawn to
this type of community at UF, and how do you plan to contribute to it in and out of the
classroom?
The following data how the number of hour worked by 200 tatitic
Cla hour frequency
10-19 40
20-29 50
30-39 70
40-49 40
200 hours worked at a tactile hour frequency is 200/40 = 50.
A recurring event's frequency is measured by how many times it occurs in a unit of time. For clarity, it is sometimes referred to as temporal frequency and is distinct from angular frequency. One occurrence per second, or hertz (Hz), is the unit of frequency. The period, which is the reciprocal of the frequency, is used to calculate the amount of time that passes between events. For instance, the period, T—or the interval between beats—is half a second if a heart beats 120 times per minute. , such as mechanical vibrations, audio signals (sound), radio waves, and light.
Learn more about frequency from
brainly.com/question/254161
#SPJ4
The graph below shows the average growth rate for 38 pairs of newborn rats. One of each pair was treated with a special hormone. The other member of each pair served as a control.
Answer: The answer is 325 grams
Explanation: Look at the graph on the y axis and x axis
Dale works as an insurance underwriter. What kind of education would Dale likely have needed for this position?
a) apprenticeship with a car mechanic
b) bachelor’s degree in finance
c) master’s degree in investing
d) doctorate in mathematics
Answer:
b) bachelor’s degree in finance
Explanation:
i took the test
1 pt Question 1 If the price of a good increases and consumers purchase more of a related good, the good is a [Select] good?
A. complemtary
B. substitute
Answer:
A complemtary is the answer
Witch represents the net force to FP=5500N
FG=6000N
Answer:
The net force is 500N downwards.
Explanation:
"When Haley is trying to pull an object upward. The below forces are acting on the object.
Fp = 5500N
Fg = 6000N
because the force of gravity is more than the force of the pull.
Fnet = Fg - Fp = 6000N - 5500N = 500N
And, the direction of the resultant force is the direction of the larger force."
Hope this helps :)
Why was public opinion mixed about the cuban war for independence?.
How does the conflict "character versus nature" tie into the theme of the story? The Grasshopper and The Ant
The conflict of character versus nature is an external conflict in literature. It is frequently represented as a person battling the environment, including natural disasters, wild animals, or the natural world's destructive side.
In The Grasshopper and The Ant, this conflict ties into the story's theme in a variety of ways.
To begin with, the narrative depicts how nature, in this case, the environment, can have an impact on our lives. Throughout the story, the grasshopper avoids the ant's attempts to prepare for the winter, preferring to sing and dance.
When the winter arrives, the grasshopper is caught unprepared and ends up hungry and freezing. The story's moral teaches readers that being ill-prepared can be disastrous, especially when it comes to nature. It also highlights the importance of being proactive in preparing for the worst.
Another way the character versus nature conflict ties into the story's theme is by highlighting the ant's perseverance and hard work. Despite the harsh circumstances, the ant remains determined and dedicated to his goal of preparing for the winter. This serves as an inspiration to readers to persevere even in the most challenging situations.
Furthermore, the story shows how nature can be both harsh and benevolent. The grasshopper suffers due to the harsh winter, but the ant's hard work also pays off in the end when he can enjoy the fruits of his labor. This teaches readers that nature can both give and take away.
Finally, the conflict of character versus nature in The Grasshopper and The Ant serves to teach readers about the importance of balance. The ant's hard work and preparation are admirable, but the grasshopper's love of life and music is also crucial. This emphasizes that while it's essential to be prepared, it's also necessary to enjoy life and not take it for granted.
For more such questions on conflict, click on:
https://brainly.com/question/26202241
#SPJ8
The breaking strengths of cables produced by a certain manufacturer have a standard deviation of 92 pounds. A random sample of 90 newly manufactured cables has a mean breaking strength of 1700 pounds. Based on this sample, find a 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer. Then give its lower limit and upper limit. Carry your intermediate computations to at least three decimal places. Round your answers to one decimal place
Answer:
To find the 95% confidence interval for the true mean breaking strength of all cables produced by the manufacturer, we can use the formula:
Confidence Interval = Sample Mean ± (Critical Value * Standard Error)
First, let's calculate the standard error, which is the standard deviation divided by the square root of the sample size:
Standard Error = Standard Deviation / √(Sample Size)
= 92 / √(90)
≈ 9.685
Next, we need to determine the critical value corresponding to a 95% confidence level. Since the sample size is large (n > 30), we can use the z-table. The z-value for a 95% confidence level is approximately 1.96.
Now we can calculate the confidence interval:
Confidence Interval = Sample Mean ± (Critical Value * Standard Error)
= 1700 ± (1.96 * 9.685)
Lower Limit = 1700 - (1.96 * 9.685)
≈ 1679.69
Upper Limit = 1700 + (1.96 * 9.685)
≈ 1720.31
Therefore, the 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer is approximately (1679.7, 1720.3). The lower limit is 1679.7 pounds, and the upper limit is 1720.3 pounds.
This is Ax + By = C, where A is positive and A, B, and C are real numbers.
what's the question?
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
(1) Farmer Ben has only ducks and cows 21 in total. He can’t remember how many of each he has. He knows
that the animals have a total of 52 legs. Assuming that each animal has all legs intact and no extra
limbs, how many of each animal does farmer Ben have? Draw a clear diagram to answer this question.
(2) On a merry-go-round, 12 horses are evenly spaced on the outside perimeter. Abe is opposite to the first
horse. It takes 4 seconds for the fourth horse to reach Abe. How long will it take the merry-go-round to
go around once? Draw a clear diagram to answer this question. Make a Diagram and solve this problem.
(3) Charmin’s daughter has $6.00 she wants to spend on a comic books and superhero cards. Comic books
cost 75 cents each, and deluxe packages of superhero cards cost $1.50 each. List all the ways she can
spend all of her money on comic books, superhero cards , or both.
(4) In how many ways can one add only three positive even numbers and get 22? Make a systematic list
and show all the possibilities.
THIS IS MY EXAM FOUR QUESTIONS CAN SOMEBODY PLZZ HELP ME AN SHOW THE WORK FROM THE BOTTOM OF MY HEART PLZZ
Answer:
Answer of question 1 :
Explanation:
Let x be the legs of ducks
And y be the legs of cows
According to the question,
2x + 4y = 52...…..(i) ( as ducks ahs two legs and as cows has 4 legs)
As he has 21 animals in total so,
x + y = 21...…..(ii)
We have make the equation. We will solve them by eliminatory method or substitution method. Here, I'll go for substitution method.
From equation (ii)
x = 21 - y....…..(iii)
Putting the value of x in equation (i),
2x + 4y = 52
2( 21 - y ) + 4y = 52
42 - 2y + 4y = 52
2y = 52 - 42
y = 10/2
y = 5 ( He has 2 cows)
putting the value of y in equation (ii)
x + y = 21
x + 5 = 21
x = 21 -5
x = 16 ( He has 16 ducks)
What's the answer the number
Answer:
Show the picture
Explanation:
Which detail from "mohandas gandhi: truth in action" introduces the idea that gandhi influenced people outside of india?.
Answer:
"In the United States, the Reverend Martin Luther King, Jr., once said that Gandhi’s words and actions showed him how to use nonviolence to lead the civil rights movement in the 1960s."
Explanation:
I took the quiz and got it right.
Is it risky to go to NASA at the age of 16?
Answer: Follow your dreams
Explanation: (Google Search )
There are no age restrictions for the NASA Astronaut Corps. Astronaut candidates have ranged between the ages of 26 and 46, with the average age being 34. Candidates must be U.S. citizens to apply for the program. There are three broad categories of qualifications: education, work experience, and medical
Answer:
Yes
Explanation:
You could be more exposed to the risks of radiation and sickness
Quantitative sociologists use and to do their research.
Quantitative sociologists use and do their research by using surveys, and experiments.
What is Quantitative Research in Sociology?
Data that can be measured must be gathered and analyzed in quantitative research.
This mainly deals with numbers rather than audio and videos.
Why do we need Quantitative sociologists?
Data must be able to be counted or quantitatively calculated to be considered measurable. Moreover, quantitative research gives researchers a way to create statistics using the data they have gathered.
There will be many methods like
ObservationsInterviewsFocus groupsSurveys etc.To know more about Sociologists visit:
https://brainly.com/question/28499072
#SPJ1
how do you make a benchmark fraction to show 3/6 is greater than 5/12?
Answer:
You can multiply 3/6 by 2/2 (because 2/2 is equal to one) to get 6/12
This allows for the denominators to be the same so then you can just compare the 2 fractions.
A commercial on television advertises a new medicine that claims to boost immunity. you want to verify that the claim is scientifically based. which source is least likely to provide you with accurate information about this new medicine? a magazine about entertainment and lifestyle trends the studies that the television ad cites a brochure from the doctor’s office the website of the governmental agency that tests health products
Answer:
The Answer is A: A magazine about entertainment and lifestyle trends
Explanation:
Answer:
The source that is least likely to give credible and accurate information on the medicine being advertised is a magazine about entertainment and lifestyle trends.
Which source will give the least accurate information on the medicine?
A lifestyle and entertainment magazine will try to focus on subjects related to fashion, celebrities and other pop cultural activities.
It will therefore be the least likely to provide you with information on the credibility of a medical drug.
In conclusion, option A is correct.
Find out more on the importance of credible information at brainly.com/question/784877.
Explanation: