Answer:
Taking a class/ Online class
Explanation:
A short-term goal is something you want to accomplish soon. A short term goal is a goal you can achieve in 12 months or less.
Hope that helps!
Which food would be an inappropriate choice to feed a child with spastic quadriplegia?
Answer:
wsdaadfsdafasdfsfgsedgvadgaeggethkhmjynfyjhjjjj
Explanation:
What physiological effect would you predict from a mutation that replaced with serine the cysteine in the constant part of the immunoglobulin light chain that is involved in disulfide-bond formation with the heavy chain?.
improving clinical care within the framework of the triple aim requires health professionals to work across disciplines and across communities. which of the following people can help providers identify community resources?
People can help providers identify community resources are Other providers, Patients, Community members.
What are the goals of the triple aim?Improving the patient experience of care (including quality and satisfaction);Improving the health of populations; and.Reducing the per capita cost of health care.In order to make a healthcare decision together, a patient and a clinician engage in shared decision-making (SDM). Decisions about surgery, drugs, self-management, and screening and diagnostic testing are a few examples. The report suggests "six goals for improvement." The objectives include patient-centeredness, efficiency, equity, safety, effectiveness, and effectiveness.
The concept has three phases: (1) offering choice, (2) outlining alternatives, frequently incorporating patient decision assistance, and (3) assisting patients in determining their preferences.
To learn more about triple aim refer to:
https://brainly.com/question/21304892
#SPJ4
Blood will enter a kidney via the renal artery. This artery branches to small segmental arteries and finally to small afferent arterioles. Each arteriole will lead to a capillary bed associated with the start of a nephron. This capillary bed is called the ___________________.
Answer:
glomerulus
The glomerulus (plural glomeruli) is a network of small blood vessels (capillaries) known as a tuft, located at the beginning of a nephron in the kidney. Each of the two kidneys contains about one million nephrons.
Explanation:
Which is not a characteristic of vitamins? options are A.saturated fat B.cholesterol C.fiber and D.amino acid
The option that is not a characteristic of vitamins is amino acid, which is option D.
What is a vitamin?A vitamin is any specific group of organic compounds essential in small quantities for healthy human growth, metabolism, development, and body function.
Vitamins are usually found in small quantities in plant and animal foods or sometimes can be synthesized.
A vitamin can contain saturated fat, cholesterol or fiber, however, an amino acid is a compound specific to protein molecules.
Learn more about vitamins at: https://brainly.com/question/24324739
#SPJ1
Mr. Wayne has a 3-year contract for his cell phone service. He pays $124.65 each month to cover everyone in his family. How much will the cell phone service cost over the 3-year period? Explain your answer.
Answer:
4487.4
Explanation:
(124.65) x (12) x (3)= 4487.4
Hope this helps! Please mark as brainiest!!!
Which combination of servings is likely to provide the. Widest variety of vitamins and minerals
The combination of servings that's most likely to provide the widest variety of vitamins and minerals includes whole grains, vegetables, fruits, dairy, and protein.
Eating a wide variety of foods is essential for getting all the nutrients the body requires to stay healthy. Vitamins and minerals are essential micronutrients that our body needs in small quantities to function correctly. Different foods provide different amounts of vitamins and minerals, which is why it's crucial to consume a variety of foods to get the essential nutrients required by the body.
Fruits and vegetables are excellent sources of vitamins and minerals, especially vitamin C, potassium, folate, and vitamin A. Whole grains such as brown rice, quinoa, oats, and barley are rich in fiber and contain B vitamins like niacin and thiamine and minerals like iron and zinc. Dairy products are rich in calcium, vitamin D, and phosphorus that are crucial for bone health.Protein-rich foods like eggs, fish, nuts, and legumes contain essential amino acids required for tissue repair and growth, iron, zinc, and vitamin B12. Consuming a variety of these food groups will ensure that your body receives a wide range of nutrients.
In conclusion, incorporating all of these food groups in the daily diet will provide the widest variety of vitamins and minerals required by the body.
For more such questions on vitamins , visit:
https://brainly.com/question/1913673
#SPJ8
advances in the of the brain are linked to children's .group of answer choicesprefrontal cortex; improved attention, reasoning, and cognitive controlparietal lobe; peripheral visionoccipital lobe; improved spatial skillstemporal lobe; hand-eye coordination and pincer grasp
Advances in the development of the brain are closely linked to children's cognitive and motor skills. Specifically, the growth of the prefrontal cortex plays a significant role in children's improved attention, reasoning, and cognitive control.
This part of the brain is responsible for higher-order cognitive functions, such as decision-making, problem-solving, and impulse control. As the prefrontal cortex develops, children demonstrate enhanced abilities in focusing their attention, understanding complex ideas, and regulating their behavior.
This ultimately supports their academic and social success. Other parts of the brain, such as the parietal, occipital, and temporal lobes, contribute to various skills like peripheral vision, spatial skills, and hand-eye coordination, respectively. However, it is the development of the prefrontal cortex that has the most significant impact on children's attention, reasoning, and cognitive control.
You can learn more about motor skills at: brainly.com/question/32106296
#SPJ11
i'll give u 25 points if u can guess mi age
Answer:
16
Explanation:
.......................
Explanation:
ARE U 19 OR 16.I GUESS...IM SORRY IF IM WRONG
Having a positive attitude helps decision making to become a more positive experience.
Answer:
true .....but what are you asking?
Compare the following three psychological theories—Piaget’s theory of cognitive development, Erikson’s theory of psychosocial development, and Kohlberg’s theory of moral development. Present your answer in a comparative table and include at least six points of comparison.
Select the correct answer.
A medical history does all of the following except:
A.
Helps ensure that it is safe for your client to participate in an exercise program
B.
Gives you information on limitations the client may have
C.
Determines how successful your client will be in developing strength
D.
Discloses chronic medical conditions
Answer:
LETTER A BEACAUSE ITS HELPFULL
34. A term to describe a body location closer to the head is:
A. lateral.
B, medial
C. superior
D. inferior.
Answer:
medial i think
Explanation:
Compare ice cream to cake. Describe what makes ice cream different from other desserts. Discuss two criticisms of ice cream in relationship to other desserts. Explain one reason that people choose this treat more in the summer than during the winter. Provide an example of an appropriate situation to eat ice cream.
Answer:
Ice-cream is a cold delicacy while cake is usually served warm or neutral temperature. Both are unhealthy to consume regularly to be honest
Explanation:
Ice cream could be good because it is obtained from milk which has nutrients. But, ice-cream is loaded with sugar. Most ice-cream companies add large amounts of sugar. Frequently eating this could lead to future health problems. Not only does lots of sugar lead to health issues but also damages your teeth.
Secondly, it is high in calories. For example, 100 grams of vanilla ice cream is equivalent to 207 calories. Why eat ice-cream when you can have a mango which is 65 calories per 100 grams.
I think ice-cream is something you shouldn't eat frequently. It'd be best if people ate ice-cream only when they craved it. But if you can't do that, eating ice-cream once or twice a week would be ok.
people usually eat ice-cream during Summer obviously because it's hot and the best thing to have when its sunny outside is a nice cone of ice-cream. Not many people eat ice-cream during Winter because it's cold and they would probably prefer lava cake or warm brownies.
which laws to protect citizens from human rights violations
Answer:
Individual people have civil and political rights guaranteed by the Bill of Rights, which include freedom of expression, religion, and organization, as well as the right to a fair trial and the prohibition of harsh and unusual punishment.
Explanation:
Hope this helps!
Please mark me as Brainlineast.
How was your experience from changing a baby’s diaper? A question from my health class assignment.
Answer:
It wasn't that bad. The baby cooperated well and stayed still.
Explanation:
Bottleneck with Multiple Flows A car wash offers two different types of wash services, deluxe wash and standard wash. The deluxe wash require(s) three steps: pre wash, wash and dry. The standard wash only require(s) two steps wash and dry The pre-wash step has a capacity of 7 cars per hour The wash step has a capacity of 11 cars per hour . The dry step has a capacity of 10 cars per hour. The demand for deluxe wash is 7 cars per hour and the demand for standard wash is 11 cars per hour Instruction: Round to the nearest integer porcentage What is the impled uhlization of the bottleneck resource? %
Rounding to the nearest integer, the implied utilization of the bottleneck resource is 164%.
To calculate the implied utilization of the bottleneck resource, we need to determine the maximum capacity of the bottleneck resource and compare it to the demand for that resource.
In this case, the bottleneck resource is the wash step because it has the lowest capacity among all the steps. The wash step has a capacity of 11 cars per hour.
The demand for deluxe wash is 7 cars per hour, and the demand for standard wash is 11 cars per hour. Since the wash step is part of both the deluxe wash and standard wash processes, we need to consider the total demand for the wash step.
Total demand for the wash step = Demand for deluxe wash + Demand for standard wash
Total demand for the wash step = 7 + 11 = 18 cars per hour
Now we can calculate the implied utilization of the bottleneck resource:
Implied utilization = (Demand for the bottleneck resource / Maximum capacity of the bottleneck resource) * 100
Implied utilization = (18 / 11) * 100 ≈ 163.6%
To know more about bottleneck resource
brainly.com/question/33655353
#SPJ11
a client is receiving total parenteral nutrition (tpn). the nurse monitors the client for complications of the therapy and should assess the client for which manifestations of hyperglycemia?
Hyperglycemia is a frequent occurrence during the administration of total parenteral nutrition (TPN) to clients. When TPN is given, glucose is usually administered at a higher concentration than that present in the blood.
As a result, the pancreas releases insulin to maintain glucose levels in the blood. However, in clients with pancreatic damage or underlying disorders, insulin release is reduced or absent, resulting in hyperglycemia.
Hyperglycemia is one of the side effects of total parenteral nutrition (TPN), which is a method of feeding patients who are unable to consume food or liquids orally. Glucose is usually given at a higher concentration than that found in the bloodstream during TPN. As a result, the pancreas produces insulin to keep the blood glucose level in check. Insulin release is reduced or absent in people with pancreatic damage or underlying illnesses, causing hyperglycemia. The nurse monitors the client for complications of the therapy, particularly manifestations of hyperglycemia.
The nurse must pay close attention to the client receiving total parenteral nutrition (TPN) and assess for indications of hyperglycemia, which is a frequent occurrence during the treatment. Hyperglycemia manifestations include frequent urination, thirst, blurred vision, headaches, and increased hunger.
To know more about Hyperglycemia, visit:
https://brainly.com/question/10926739
#SPJ11
Describe how the author develop her argument in this part of the article?
Answer:
She made her point on what she believed and she kept the argument strong.
Explanation:
Answer: its c on edgunity
Explanation:
HELP!
ANSWERS NEEDED IMMEDIATELY!!
Answer:
call the ambulance or 911 or 999
The thymus gland produces a hormone that is important in the differentiation of
A: Glial cells
B: Dermal cells
C: Option 3
D: Muscle cells
Subject: Anatomy
Answer:
Hope this helps ^^
Explanation:
The correct answer is C: Option 3. The thymus gland produces a hormone that is important in the differentiation of T cells, which are a type of immune cell involved in the body's immune response. The differentiation of T cells is crucial for the proper functioning of the immune system. None of the provided options (glial cells, dermal cells, or muscle cells) are directly associated with the role of the thymus gland hormone.
Acting or reacting hurriedly based on emotions rather than reason is:
A.) planning
B.) impulsive
C.) thinking things through
D.) contingent
Answer:
impulsive
Explanation:
impulsive is making a guess by what you think fast.
Answer:
B.) Impulsive
Explanation:
Hope this helps! :)
1. Explain the difference between unconditional and conditional strokes
and give an example of each.
H
Words needed: 50
The unconditional positive stroke is expressing our affection for someone, but expressing our admiration for someone's cuisine is a conditional positive stroke.
What are unconditional and conditional strokes?Strokes are "a unit of recognition" in which one person acknowledges another by an action or statement.
Expressing our love for someone is an example of an unconditional positive stroke, but praising their cooking is a conditional positive stroke. The former affects a person's entire being, whereas the latter simply affects a small piece.
While expressing your anger for someone is the ultimate unconditional negative stroke, critiquing their cooking is a conditional negative stroke.
Learn more about unconditional and conditional strokes at: https://brainly.com/question/26482925
#SPJ1
Which website author is most likely to offer advice based on scientific
research?
A. A professor at a well-respected university
B. A chemist who develops supplements
C. An activist at a radical nonprofit organization
D. A person with "Dr." in front of his or her name
Answer:
The answer is: A professor at a well-respected university.
Explanation:
Please mark as brainless.
A professor at a well-respected university is most likely to offer advice based on scientific research.
What do you mean by scientific research?"Scientific research is the research performed by applying systematic and constructed scientific methods to obtain, analyze, and interpret data."What is a professor?"A professor is a university academic of the highest rank."The person having this rank is expert in his field and have done a research work.They would not give advice randomly, they give advice which is valid and have been studies.Hence, the correct option is A. A professor at a well-respected university.
To know more about scientific research here
https://brainly.com/question/832053
#SPJ2
which of these is an example of drug misuse?
Answer:
Explanation:
Answer:
B. chen takes Andys prescription medicine for back pain
Explanation:
How many whole graham crackers would a person on a 2000 calorie diet need to eat to obtain 100% of the Daily Value (DV) for fiber? Would this be a healthy way to get 100% of your DV?
Answer:
74
Explanation:
DV of fiber should be 21 to 38 grams daily
1 graham cracker has 0.4 grahams of fiber
53-95
average
74
past, present and future long term care?
Answer:
? what are you trying to ask?
Food low in fat and foods prepared without adding fat ( 2 words)
Answer:
fat free and lean fish is low on fat so say flounder or whatever your being asked
Explanation:
Which of the following drugs affect the central nervous system?
A.
Stimulants
B.
Depressants
C.
Hallucinogens
Answer:
B. depressants
Explanation:
Depressants make your body functions calm and slow down. Your nervous system controls the ability to relax, so depressants also make your body more relaxed. They're utilized mainly to treat anxiety, panic, stress reactions, and more, but drowsiness is a common side effect.
Dan Buettner describes several “blue zones” where people easily live to be 100 years old, and do so vigorous.
List some factors that contribute to people who live in Sardinia or Okinawa living to 100+ years old?
Several factors contribute to the longevity and vitality of people living in Sardinia and Okinawa, as observed in the "blue zones" identified by Dan Buettner. Some of these factors include:
1. Diet: Both Sardinia and Okinawa have traditional diets that emphasize plant-based foods, including vegetables, fruits, whole grains, legumes, and nuts. These diets are typically low in processed foods and high in antioxidants, fiber, and healthy fats, contributing to overall good health and longevity.2. Active lifestyle: Physical activity is a natural part of the daily routine in both Sardinia and Okinawa. The inhabitants engage in regular physical activities such as gardening, walking, and traditional forms of exercise. This active lifestyle promotes cardiovascular health, muscle strength, and overall well-being.3. Social connections: Strong social connections and a sense of community play a vital role in the lives of the centenarians in Sardinia and Okinawa. They have close-knit social networks and often participate in community activities, which provide support, purpose, and a sense of belonging.4. Stress reduction: Both cultures prioritize stress reduction and have built-in mechanisms for relaxation. Practices such as daily naps, meditation, and rituals help manage stress levels, promoting mental well-being and longevity.5. Purpose and engagement: The centenarians in Sardinia and Okinawa maintain a strong sense of purpose and remain engaged in meaningful activities throughout their lives. They have a clear sense of identity, often fulfilling roles within their families and communities, which contributes to their overall satisfaction and longevity.6. Environmental factors: The natural environments in Sardinia and Okinawa provide opportunities for an active lifestyle, access to fresh and nutritious food, and clean air. These favorable environmental factors support healthy living and longevity.It's important to note that these factors are not exclusive to Sardinia and Okinawa but can be adapted and incorporated into lifestyles in various regions to promote health and well-being.
\(\huge{\mathfrak{\colorbox{black}{\textcolor{lime}{I\:hope\:this\:helps\:!\:\:}}}}\)
♥️ \(\large{\underline{\textcolor{red}{\mathcal{SUMIT\:\:ROY\:\:(:\:\:}}}}\)