Which of the following are the units of a henry and a farad respectively

Answers

Answer 1

Henery and a farad are the respective unit for electrical inductance and capacitance.

What is Electric capacitance?

This is defined as the ratio of the amount of electric charge stored on a conductor to a difference in its electric potential.

The unit is Farad and was named after the English physicist Michael Faraday.

Read more about Electric capacitance here https://brainly.com/question/27258294

#SPJ1


Related Questions

explain the meaning of scouting

Answers

Answer:

1) the action of gathering information about enemy forces or an area.

2) the action of one that scouts

Explanation:

please mark me as brainly

Answer:

to explore an area to obtain information (as about an enemy) : to make a search. : to work as a talent scout. transitive verb. : to observe in order to obtain information or evaluate.

What is the meaning of “teach them truth about the First Americans” as it is used in Paragraph 1 of the text?

Answer choices for the above question

A. Indians should not be kept out of history books altogether.

B. History books should acknowledge that the British were murderous and abusive to colonists and Indians alike.

C. Children should get a school holiday in remembrance of Wounded Knee Massacre.

D. There should be more unbiased and thorough accounts of Indian history taught in schools.

Answers

Answer: freaky friday

Explanation:

Where is the incorrect pronoun shift. Rewrite the sentence correctly.

The band played its fine concert last night.

Answers

The sentence is grammatically correct and there is no incorrect pronoun shift.

What is a pronoun?

A pronoun is a word used to replace a noun or noun phrase in a sentence. It is used to avoid repetition of the same noun or noun phrase in a sentence, making the sentence more concise and readable.

Examples of pronouns include he, she, it, they, we, me, him, her, them, us, and so on. Pronouns can be categorized as personal pronouns, possessive pronouns, reflexive pronouns, demonstrative pronouns, indefinite pronouns, relative pronouns, and interrogative pronouns.


Pronouns are important because they improve the clarity and flow of a sentence by replacing repetitive nouns or noun phrases.

The pronoun in the above is it's.

Learn more about pronouns:
https://brainly.com/question/30510319
#SPJ1

which of the 3 states of matter dose not have a fixed volume ​

Answers

i think the answer is gas

In addition to needs, what should you plan for first when
creating a budget?
Possible charitable donations
Recurring expenses
Investments
Shopping money

Answers

the answer is recurring expenses

Answer:

B. Recurring expenses

Explanation:

What amount should elaine report for her total medical and dental expenses on schedule a itemized deductions

Answers

Answer:

Explanation:

c

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

how do you make a benchmark fraction to show 3/6 is greater than 5/12?

Answers

Answer:

You can multiply 3/6 by 2/2 (because 2/2 is equal to one) to get 6/12

This allows for the denominators to be the same so then you can just compare the 2 fractions.

points e(–1, –2) and f(4, –2) are the vertices of a square. give the coordinates of three possible pairs of points for the other two vertices.

Answers

The coordinates of the two remaining vertices of the square are (4, 3) and (-1, 3).

The given parameters;

first coordinate point, e = (-1, -2)second coordinate point, = f = (4, -2)

The coordinates of the remaining two vertices is calculated as follows;

let of a side of the square = 4 - (-1) = 4 + 1 = 5

The square has a side of 5 unit length

the coordinate in y-direction to make 5 units with (4, -2);

                                                                = y₁ - (-2) = 5

                                                                = y₁ + 2 = 5

                                                                = y₁ = 3

                                                     the coordinate = (4, 3)

the coordinate in y-direction to make 5 units with (-1, -2);

                                                                = y₂ - (-2) = 5

                                                                = y₂ + 2 = 5

                                                                = y₂ = 3  

                                                     the coordinate = (-1, 3)

Thus, the coordinates of the two remaining vertices of the square are (4, 3) and (-1, 3).

Learn more here:https://brainly.com/question/17147258

were you able to have the planet leave the orbit of the stars?

Answers

Answer:

yes

Explanation:

At this hospital, 2% of patients are classified as Level 1, 7% are classified as Level 2, 30% are

classified as Level 3, 10% are classified as Level 5, and the remaining percentage of patients are

classified as Level 4.

At this hospital, 99% of Level 1 patients stay overnight, 90% of Level 2 patients stay overnight, 30%

of Level 3 patients stay overnight, 10% of Level 4 patients stay overnight, and 1% of Level 5 patients

stay overnight.

Kennedy (a nurse at this hospital) randomly selects a patient who is staying in the hospital

overnight. What is the probability that this patient was initially classified as Level 1? Round to the

three decimal places.

Hint

P(Level 1 GIVEN overnight) =

1Gilboy, N. , Tanabe, T. , Travers, D. , & Rosenau, A. M. -2011. Emergency severity index (ESI): A triage tool for

mergency department care Version 4. Implementation Handbook 2012 Edition Arena

Answers

Hi, the answer to that 0.02 or 2%. hope it helps.

All of these are NEGATIVE consequences of irrigation EXCEPT *
A . drains water out of rivers, lakes or underground
B . increase salt in the soil
C . changes air temperature and moisture
D . grows large amounts of food

Answers

I think the answer is D. Because it doesn’t seem negative

Find the value of the exponent c that makes the second expression equivalent to the first expression where x ≥ 0 and y ≥ 0. Es004-1. Jpg c =.

Answers

Answer:

4

Explanation:

just did it

Determine the rhyme scheme in scaffolding. Why do you think Seamus Heaney might have chosen this rhyme scheme for a poem about a couples relationship ?

Answers

The rhyme scheme in "Scaffolding" by Seamus Heaney is ABAB CDCD EFEF GHGH.

The poet might have chosen this rhyme scheme for a poem about a couple's relationship to reflect the stability and balance of a healthy relationship. The alternating rhyme scheme of ABAB CDCD EFEF GHGH creates a sense of symmetry and order, which mirrors the scaffolding that the speaker describes in the poem. The poem's central metaphor of a scaffold that supports a building also suggests the idea of a strong foundation that supports a lasting relationship. The use of a regular rhyme scheme may also create a sense of predictability and stability, which can evoke the sense of security and comfort that a loving relationship can provide.

Overall, the rhyme scheme helps to convey the theme of stability and balance in a healthy relationship, which is at the heart of the poem.


Please mark me as Brainliest

where do tornadoes most often occur in the United States

Answers

Answer:the Great Plains of the central United States

Explanation:

The narrator implies that Mrs. Quabarl favors a form of education that emphasizes

Answers

Active engagement is the narrator implies that Mrs. Quabarl favors a form of education that emphasizes.

What is meant by active engagement ?

The majority of the time, passive involvement is little effort and doesn't take up much of your time or cognitive burden. On the other hand, active engagement requires a lot of work and cognitive burden.

Students are less likely to become disinterested in what they are taught when they are actively participating in the learning process. Students who are actively participating in class had higher exam performance and lower dropout rates.

A child who is actively engaged is prepared to interact and learn, to work hard, to interact with those around them, and to "hang in" when faced with difficulties or change

The complete question is : The narrator implies that Mrs. Quabarl favors a form of education that emphasizes-

Traditional values

Active engagement

Artistic experimentation

Factual retention

To learn more about active engagement refer to:

https://brainly.com/question/28426142

#SPJ1

Active engagement is the narrator implies that Mrs. Quabarl favors a form of education that emphasizes.

What is meant by active engagement ?The majority of the time, passive involvement is little effort and doesn't take up much of your time or cognitive burden. On the other hand, active engagement requires a lot of work and cognitive burden.Students are less likely to become disinterested in what they are taught when they are actively participating in the learning process. Students who are actively participating in class had higher exam performance and lower dropout rates.A child who is actively engaged is prepared to interact and learn, to work hard, to interact with those around them, and to "hang in" when faced with difficulties or change

The complete question is : The narrator implies that Mrs. Quabarl favors a form of education that emphasizes-

Traditional values

Active engagement

Artistic experimentation

Factual retention

To learn more about learning process refer to:

https://brainly.com/question/5317263

#SPJ1

Use the given data to construct a confidence interval for the population proportion p of the requested level.
X=47
N=71
Confidence level 98

Use the given data to construct a confidence interval for the population proportion p of the requested

Answers

The confidence interval for the population proportion p at a 98% confidence level is approximately (0.55297, 0.77097).

How to calculate the value

Given data:

X = 47 (number of successes)

N = 71 (sample size)

Confidence level = 98%

First, we need to calculate the sample proportion:

p = X/N = 47/71 ≈ 0.66197

Now, we can calculate the margin of error (E):

E = Z * √((p1 - p))/n)

= 2.326 * √((0.66197(1 - 0.66197))/71)

≈ 0.109

Finally, we can construct the confidence interval:

CI = p ± E

= 0.66197 ± 0.109

Therefore, the confidence interval for the population proportion p at a 98% confidence level is approximately (0.55297, 0.77097).

Learn more about confidence interval on

https://brainly.com/question/20309162

#SPJ1

What is the slope of the line that passes through the points (2, 9)(2,9) and (18, -3)(18,−3)?

Answers

The slope's formula is -->  \(\frac{y2-y1}{x2-x1}\)

Let's set:

(x1, y1) = (2,9)(x2, y2) = (18,-3)

   either other works, I just chose it that way

So:

  \(slope = \frac{-3-9}{18-2} =\frac{-12}{16} =-\frac{3*4}{4*4} =-\frac{3}{4}\)

Hope that helps!

In a college football training session, the defensive coordinator needs to have 10 players standing in a row. Among these 10 players, there are 1 freshman, 2 sophomores, 4 juniors, and 3 seniors. How many different ways can they be arranged in a row if only their class level will be distinguished?

Answers

There are 30,240 different ways the 10 college football players can be arranged in a row, considering only their class level.

In order to find the number of different ways the 10 college football players can be arranged in a row, considering only their class level, you'll need to use the concept of permutations with repetition.

There are 1 freshman, 2 sophomores, 4 juniors, and 3 seniors, which sums up to 10 players. To find the number of arrangements, you'll use the formula:

Number of arrangements = 10! / (1! x 2! x 4! x 3!)

10! represents the total number of players factorial, and the factorials in the denominator represent the number of players in each class level.

By calculating the expression, you get:

Number of arrangements = 3628800 / (1 x 2 x 24 x 6) = 30,240

You can learn more about permutations at: brainly.com/question/30882251

#SPJ11

write the infinitives for sentences without infinitive right none: Ringo the cat likes to nap indoors every morning​

Answers

There is already an infinitive in the sentence: "to nap". The infinitive in this sentence is "to nap".

Define infinitive.

An infinitive is a grammatical term used to describe the basic or root form of a verb. In English, infinitives are usually preceded by the word "to," such as in "to walk," "to eat," "to sing," etc. Infinitives can be used as a noun, adjectives, or adverbs in a sentence, and they can function as the subject, object, complement, or modifiers of a sentence.

The infinitive is a grammatical term that refers to the basic form of a verb, usually preceded by the word "to." In the sentence "Ringo the cat likes to nap indoors every morning," the infinitive is "to nap, "It is the verb's basic form when the preposition "to" is added. The infinitive in this sentence is used to express the action that Ringo the cat enjoys doing, which is taking a nap indoors every morning.

Therefore, "To nap" serves as the sentence's infinitive.

To learn more about infinitives click here

https://brainly.com/question/8990731

#SPJ1

William’s dad taught him how to write computer codes from a young age. Now, the high school senior wants to work as a programmer. How can he best position himself to do this?.

Answers

Answer:

William should go to work as an intern for his father’s software company to get experience before enrolling in a community college.

William should go to an educational seminar sponsored by a private software company to get experience before enrolling in a career college.

William should enroll at a four-year university as a computer science major and go to work as an intern for a software company.

William should enroll at a technical school that specializes in computer programming and go to work as an intern for a software company.

Explanation:

Consider a specific school or workplace. Who would be the external customers for that organization?

Answers

The person like the teachers, other universities and the students would be the external customers for that organization.

What is an organization?

An organization is an entity made up of individuals or a group of individuals who gather together for a particular purpose, according to the definition of what is an organization. Then, an organization may be both profitable and unsuccessful.

An external user can be defined as a person who is not directly connected to the organization but is doing some kind of important role when it comes to it right could in a University or there will be teaching,  staff member, and students.

Learn more about organization, here:

https://brainly.com/question/23420077

#SPJ1

A light source is shining on a vertical surface or a slanted surface as shown 3 points
below. Which statement is correct?
Surface is vertical
Surface is tilted
The light energy that hits the vertical surface is stronger because it is concentrated on
a smaller area.
The light energy that hits the vertical surface is weaker because it is concentrated on
a smaller area.
The light energy that hits the slanted surface is stronger because it is concentrated on
a larger area.
The light energy that hits the slanted surface is stronger because it is concentrated on
a smaller area

Answers

Answer:

The light energy that hits the vertical surface is stronger because it is concentrated on a smaller area.

Explanation:

Let A = {1, 2, 3, 4), B = {4, 5, 6), and C= {6, 7). Find:

a.n(AUB)
b. n(BUC)
C. n(AUBUC)
d. n(A-B)
e. n(B-C)
f. n(A-C)

Answers

Answer:

a. {1, 2, 3, 4, 5, 6}

b. {4, 5, 6, 7}

c. {1, 2, 3, 4, 5, 6, 7}

d. {1, 2, 3}

e. {4, 5}

f. {1, 2, 3, 4}

Explanation:

U represents a union between two sets, meaning every element that is in either set A or B will be included in the union set.

AUB = {x: x ∈ A and x ∈ B}

'-' represents the difference in sets, meaning that every element that is in the first set and NOT in the second set is included.

A-B = {x: x ∈ A and x ∉ B}

Hope this helps. If you need anything explained more, please let me know.

Do you agree on the indigenization movement in up diliman.

Answers

Answer:

I agree.

Explanation:

The indigenization movement aims to bring about a resumption of cultural values native to a region. In addition to having the objective of integrating the natives of an area in the social, economic and political life of the place. This process is very positive when we see that it promotes an appreciation of the concepts of origin of a region that were modified through imperialism and the domination of foreign nations.

In this way, we can agree with the indigenization process, but it is necessary to reinforce that the native concepts of a nation must be adapted to modern life, without losing its essence, so that the process is beneficial.

Why can Dry food such as instant noodles, biscuits and potato chips be stored for a long time

Answers

Answer:

Dry foods such as instant noodles, biscuits and potato chips can be stored for a long time because they contain very little moisture. Moisture is what causes food to spoil quickly. Dry foods that contain less than 10 percent of moisture are the perfect candidates for long-term storage. Anything higher than ten could be difficult. 13% is a crucial number, with any foods higher than that posing too high of risk towards bacteria, mold, and fungus growth.

To store dry food properly, it should be kept in a cool and dry place. The storage temperature helps determine the length of storage; the higher the temperature, the shorter the storage time. Dried foods are susceptible to insect contamination and moisture reabsorption and must be properly packaged and stored immediately.

Explanation:

Hope this helps

Answer:

well exposing this things to air can make them spoil meaning they put preservatives in the packet of the biscuits the preservatives arent perment so they could spoil in the case,while exposing them to air can make them soft leading to spoilage

which is not something that occurs in translation?

Answers

Answer:

DNA transcription into a complementary strand of mRNA does not occur during translation process.

Explanation:

DNA you know what I mean

If a = 5/2 and 2a = 2x, what is the value of x ?

Answers

Answer:

2.5

Explanation:

The lane markings in this image indicate that _____

A. Both cars are approaching a passing zone
B. Both cars are leaving a no passing zone.
C. It is legal to pass in either direction
D.both cars are currently in a passing zone

The lane markings in this image indicate that _____A. Both cars are approaching a passing zone B. Both

Answers

Answer:

D

Explanation:

Both cars have a yellow dashed line, which means that cars can currently use the other lane.

Use the drop-down menus to identify the career that matches each description. Analyzes data about diseases and disorders: schedules appointments, answers phones, and checks in patients at a medical clinic: listens to audio recordings of medical reports and types them:.

Answers

Answer:

1:epidemiologist 2:medical secretary 3: medical Transcriptionst

Explanation:

I got it right

A health career is a professional occupation in the medical and healthcare fields. It might be a medical radiologic assistant, clinical assistant, physician assistant, etc. They examine the patients' illnesses and provide treatment for them.

What is healthcare?

The enhancement of one's health through the prevention, diagnosis, treatment, amelioration, or cure of disease, illness, injury, and other physical and mental impairments in humans is known as health care or healthcare.

The many medical specialties can be explained as follows:

Epidemiologists are medical professionals who study the causes and trends of diseases and disorders. They do study on diseases, explore preventative measures, and develop health regulations.Medical secretaries set up appointments, gather and record patient data, and handle patient billing.The professionals that listen to the audio and turn it into written statements are known as medical transcriptionists.

Thus, these can be the match between the career and given description.

For more details regarding healthcare, visit:

https://brainly.com/question/12881855

#SPJ5

Other Questions
Read the following excerpt from the article "Vision, Voice and the Power of Creation: An Author Speaks Out," by T. A. Barron, and answer the question that follows:Yet deeper than character, or even place, is another concept: voice. More than any other doorway to the imagination, I find this one the trickiest to openand the hardest to close. For a character's true voice is heard, its tones, cadences, and ideas are long remembered.The ancients [people from ancient history] used anima, in fact, to describe breath as well as soul. That is wholly appropriate, for in the breaththe voiceof a character lies its essential spirit. If the writer can truly hear the voice of a character, so will the reader.Which phrase explicitly states the author's attitude about voice? It is the trickiest door to open. The ancients invented it. Only the writer hears it. The reader will always hear it. What is the value of the discriminant for the quadratic equation zero equals 2x^2+x-3 looking at global temperature distributions, it is seen that the latitudinal temperature gradient is weakest in the hemisphere experiencing winter it is difficult to explain the behavior of isotherms over the continents temperatures over land are colder than those over water at the same latitude in water temperatures increase poleward Someone plz help me plz ;-; on both plzzzz the Simulation Challenge from the Knowledge Matters website on Market Segmentation:-In this Challenge Phase, you are responsible for the marketing plan for three concerts at Fire Island Stadium.You have a total spending budget of $180,000. You can split this between the three concerts in any way that you like.-Use Reports>>Event Reports and the Future Events tab to see what bands are playing.Use Reports>>Band Research Report to learn about the fan base of each band.Use Social Media Promotion to design ads, narrow down a target audience, and book and run the ads.Your specific goal is total ticket sales (attendance) of 60,000 over the three concerts while keeping spending at or below your budget of $180,000.To monitor your progress against your budget and ticket sales goal, you can click the CURRENT GRADE link below. It will also show you your current grade.If you make the goal, the simulation will automatically stop and submit your grade.You can also click Submit below to submit your score. At your Professor's discretion, you can retry the Challenge Phase multiple times. Only your best grade will count.Goal for 100% Grade: Ticket sales of at least 60,000; spending at or below $180,000.Band 1:FAN AGE16-24 53 %25-39 24 %40-54 23 %55+ 0 % What is the standard deviation of data set? 6,4,9,5,5,4,5 Round the answer to the tenths place. If a number is divisible by 10, then its ones digit is 0 TRUE OR FALSE What was the impact of yellow journalism quizlet? Q1. The menu structure of Tableau changes drastically from one version to the next. Can you navigate this tutorial in the next (or previous) version of Tableau?Q2. Different chart types are recommended for different types of data. How would you characterize these chart types? What is it about the data that leads to the recommendationsQ3. Is Tableau biased in any way? Is it easier to make some kinds of arguments with Tableau than others?Q4. Tableau accepts live data and allows you to connect your visualization to live, changing data. Suppose the point you are trying to make is no longer supported by data in future. Will you be blamed for that change?Q5. Tableau makes a lot of default choices that you changed. Do you think it could (or should) learn your preferences over time? What would it take to do that?Q6. What is a data visualization? What would have to be subtracted from these pictures so that they could not be called data visualizations? What property of a substance does its specific heat capacity describe?OA. How much heat is needed to melt itOB. How much kinetic energy it containsO C. How much heat it takes to raise the temperatureD. How good an insulator it is suppose that the chicken industry is in long-run equilibrium at a price of $5 per pound of chicken and a quantity of 350 million pounds per year. suppose the surgeon general issues a report saying that eating chicken is bad for your health. before achilles reenters the battle, he is warned that he is fated to die shortly after he kills hector. who warns him? Imagine you work for the federal government, and it is your job to convince U.S. citizens to support the war effort. Develop a slogan or message to convince people to support the war. How and why is Chinese New Year celebrated? look at the attached image and answer the question please! f(x) = 9x +5; find f(10) I EL Calibri 100% AP Normal text 6 7 1 + 1 13 2 53 3. A plcture 101 feet long is to be centered on a wall that is 141 feet long. How much space is there from the edge of the wall to the plcture? a. Solve the problem arithmetically. Solve the problem algebraically. Analyse how the processes chain of market playan important rolein the market system? 25. The sides of the base of the square prism drawn below have been doubled, but its height has not been changed. Determine the ratio of the prism's new volume to its original volume.A.8:1B.2:1C.4:1D.16:1 1. The nonfiction novel was a creation of __________ writers. (1point)absurdistmodernistpostmodernisttranscendentalist2. World War I had the greatest influence on writers of the__________ liter