What evidence is there that CRISPR can edit the DMD gene?

Answers

Answer 1

A study published in Science in 2016 reported successful editing of the DMD gene in mice using CRISPR-Cas9. The researchers used a viral vector to deliver the CRISPR-Cas9 system to the muscle tissue of the mice and observed improvements in muscle function and pathology.

What is CRISPR-Cas9?

CRISPR-Cas9 is a powerful gene editing technology that allows scientists to precisely and efficiently modify cell DNA sequences. CRISPR stands for "clustered regularly interspaced short palindromic repeats," which refers to a specific type of DNA sequence found in bacteria and other organisms.

How does CRISPR-Cas9 works?

The CRISPR-Cas9 system works by using a guide RNA (gRNA) to target a specific DNA sequence for editing. The gRNA is designed to bind to a specific location in the genome, and directs the Cas9 protein to cut the DNA at that location.

To know more about DNA, visit here:

https://brainly.com/question/264225

#SPJ4


Related Questions

Plz help:
b. Compare dominant and recessive traits –
c. Compare pure and hybrid offspring –

Answers

Answer:

b. What is the difference between dominant and recessive traits? Dominant traits are always expressed when the connected allele is dominant, even if only one copy of the dominant trait exists. Recessive traits are expressed only if both the connected alleles are recessive.

c. In the simplest possible terms, purebreds are the offspring that result from mating between genetically similar parents while hybrids are the offspring that are the result of mating between two genetically dissimilar parents.

Explanation:

Answer:

b. Dominant traits are always expressed when the connected allele is dominant, even if only one copy of the dominant trait exists. Recessive traits are expressed only if both the connected alleles are recessive.

Explanation:

c. purebreds are the offspring that result from mating between genetically similar parents while hybrids are the offspring that are the result of mating between two genetically dissimilar parents.

PLEASEEE HELP!!!!

Phycobiliproteins are complex proteins in cyanobacteria that absorb light energy. There are three different kinds of phycobiliprotein molecules used to pass light to chlorophyll: phycoerythrin—responsible for capturing green light, phycocyanin—responsible for capturing orange-red light, and allophycocyanin—responsible for capturing red light.

Since light can only penetrate to certain depths in oceans, phycobiliproteins capture the light available and pass it through various pathways of phycobiliproteins until the emitted light is red, which is absorbed by chlorophyll. Use the figure below to answer the following questions.


1. Explain the relationship between chlorophyll absorption and wavelength.


2. Justify the claim that photosynthetic organisms that live less than 25 feet below the surface of the ocean do not need phycoerythrin to survive. Provide reasoning that explains this claim.

Answers

1.) Explain the relationship between chlorophyll absorption and wavelength.

Answer:

As shown in detail in the absorption spectra, chlorophyll absorbs light in the red (long wavelength) and the blue (short wavelength) regions of the visible light spectrum. Green light is not absorbed but reflected, making the plant appear green. Chlorophyll is found in the chloroplasts of plants.

2.) Justify the claim that photosynthetic organisms that live less than 25 feet below the surface of the ocean do not need phycoerythrin to survive. Provide reasoning that explains this claim.

Answer:

The three most common organisms at the bottom of the Mariana Trench are xenophyophores, amphipods and small sea cucumbers (holothurians), Gallo said. The single-celled xenophyophores resemble giant amoebas, and they eat by surrounding and absorbing their food.

Note: I apologize if you don't like or my answer's are wrong.

There is great relationship between absorption of chlorophyll and wavelength.

There is direct relationship between chlorophyll absorption and wavelength because chlorophyll absorb the energy of certain wavelengths of light, that initiates the reactions of photosynthesis. The best wavelengths of visible light that is used by the plant during the process of photosynthesis fall within the blue range (425–450 nm) and red range (600–700 nm).

The photosynthetic organisms that live less than 25 feet below the surface of the ocean do not need phycoerythrin to survive because the green light does not needed by the plant for the process of photosynthesis. Only red and blue light is used for making food so phycoerythrin which is responsible for capturing green light is not needed by the plants for their survival so we can conclude that there is direct relationship between absorption of chlorophyll and wavelength.

Learn more: https://brainly.com/question/25095878

fever in humans and other animals is often a response due to the introduction of a foreign pathogen. research shows elevated body temperatures slow the growth of many pathogens. this figure shows the basal temperature (normal) and fever temperature (higher) for various vertebrate species. if fever conferred only benefits, and had no costs, how might you expect this graph to differ from what is currently seen?

Answers

If fever conferred only benefits and had no costs, we might expect to see all species responding with the same elevated temperature range during an infection.

A pathogen is a microorganism, such as a virus, bacterium, fungus, or parasite, that causes disease in its host. Pathogens can be transmitted from one organism to another through various means, such as direct contact, contaminated food or water, or through the air. When a pathogen enters the body, it can cause an immune response, which can include fever, inflammation, and other symptoms as the body attempts to fight off the infection.A pathogen is a microorganism, such as a virus, bacterium, fungus, or parasite, that can cause disease in a host organism. Pathogens can be found in a wide range of environments, including soil, water, and air, and can be transmitted through direct contact, droplets, contaminated surfaces, or vectors such as insects or animals.Pathogens can cause a wide range of illnesses, from mild infections to life-threatening diseases. Common examples of pathogenic microorganisms include the influenza virus, Streptococcus bacteria, Candida fungus, and Plasmodium parasite.The body has several defense mechanisms to protect against pathogens, including the immune system, which is responsible for recognizing and attacking foreign invaders. Vaccines can also be used to stimulate the immune system to produce a protective response against specific pathogens.Proper hygiene and sanitation practices, such as hand washing, food safety measures, and safe disposal of waste, can help prevent the spread of pathogens. Antibiotics and other

To know more about pathogen visit :

https://brainly.com/question/13051879

#SPJ11


Describe the movement of water if cells are in a hypertonic solution, hypotonic solution, and isotonic solution.
Why?

Answers

Water molecules move inside the cell in a hypotonic solution causing it to swell


Water molecules move outside the cell in a hypertonic solution causing it to shrink


Water molecules in an isotonic solution does not move inside or outside the cell and the cell’s volume will remain stable

Based on this information , scientists could predict that the base______ pairs with _____ and the base _____pairs with ________ in the formation of the DNA molecule

Answers

Based on this information, scientists could predict that the base Adenine pair with Thymine and base Cytosine pair with Guanine in formation of the DNA molecule.

What is meant by base pairs?

Base pairs are the building blocks of DNA molecule. The base pair consists of two nitrogenous bases that are complementary to each other and held together by hydrogen bonds.

Four types of nitrogenous bases in DNA are as : adenine (A), thymine (T), guanine (G) and cytosine (C). Adenine always pairs with thymine, and guanine always pairs with cytosine, following base-pairing rules of DNA. The sequence of these base pairs along the DNA molecule carries genetic information and determines the genetic code.

To know more about base pairs, refer

https://brainly.com/question/3372278

#SPJ1

In one paragraph, report your results from the RBC tonicity experiments, and address the following questions: a. Is the concentration of an isotonic sucrose solution the same as the concentration of an isotonic NaCl solution? If the isotonic concentrations of NaCl and sucrose are different, provide an explanation. b. What were your control conditions in this experiment? c. Provide an explanation for your observations.

Answers

In the RBC tonicity tests, we looked at how different solutions affected the size and shape of red blood cells. (RBCs). The three solutions that we examined were isotonic (0.9% NaCl and 5% sucrose), hypertonic (10% NaCl), and hypotonic (distilled water).

Why are hypertonic, hypotonic, and isotonic terminology used to describe why red blood cells swell in distilled water?

The contents of red blood cells are hypotonic to distilled water. When a red blood cell is immersed in distilled water, it develops an osmotic potential. Osmosis will cause the cell to expand and ultimately burst.

What effect does the tonicity of a solution have on a cell?

the connection between the tonicity of a solution and how it influences a cell's volume. Isotonic liquids are those that do not change the volume of a cell. In a hypotonic solution, a cell will grow while in a hypertonic one, it will constrict.

To know more about red blood visit:-

https://brainly.com/question/12265786

#SPJ1

Identify a 20
20-residue segment that could form a transmembrane α helix in this protein sequence (from the mosquito protein Orco).
FRYVNGPVLIRKLYSWWNLIMILLQYFAIM-
GNLVMNTGDVNELTANTITT

Answers

To identify a 20-residue segment that could form a transmembrane α helix in the mosquito protein Orco, you should look for a stretch of hydrophobic amino acids. In the provided protein sequence, a potential 20-residue segment is:
WWNLIMILLQYFAIMGNLVM

Transmembrane α helices are structural elements commonly found in membrane proteins. They play a crucial role in spanning the lipid bilayer of cell membranes. These helices are typically composed of hydrophobic amino acid residues that interact with the hydrophobic core of the lipid bilayer, while the hydrophilic residues face the aqueous environment inside or outside the cell.

In the given protein sequence "WWNLIMILLQYFAIMGNLVM," the segment "WWNLIMILLQYFAIMGNLVM" contains a majority of hydrophobic residues, such as tryptophan (W), isoleucine (I), leucine (L), and valine (V). These hydrophobic residues are known to be favorable for membrane insertion as they can interact with the hydrophobic environment of the lipid bilayer.

The presence of a continuous stretch of hydrophobic residues in the given segment suggests the possibility of it forming a transmembrane α helix. However, it is important to note that additional factors, such as the overall protein structure and the presence of specific transmembrane helix prediction algorithms, would be required to determine the presence and stability of a transmembrane α helix in a protein. Experimental validation and further analysis would be necessary to confirm the presence of transmembrane regions.

Learn more about hydrophobic amino acids:

https://brainly.com/question/30764085

#SPJ11

in regard to sense organs what is punctate distribution

Answers

Punctate distribution refers to a scattered or spotty arrangement of sensory receptors in a particular region of the body, such as the skin or mucous membranes.

The term "punctate" comes from the Latin word "punctum," which means "a point," and in this context, it refers to the small, discrete areas where sensory receptors are located.

For example, in the skin, punctate distribution is seen in the arrangement of the sensory receptors responsible for detecting light touch, pressure, and temperature.

These receptors are not evenly distributed throughout the skin but are concentrated in certain areas, resulting in the punctate distribution of sensation.

In the tongue, punctate distribution is seen in the arrangement of taste buds, which are concentrated in certain regions of the tongue.

Understanding the punctate distribution of sensory receptors is important in clinical settings as it helps to locate areas of sensory deficit or abnormal sensory response.

To know more about "Sensory receptors" refer here:

https://brainly.com/question/30227541#

#SPJ11

Suppose the risk-free rate is equal to 1%. Which one of the following portfolios has the lowest Sharpe ratio?
a. Expected return of 5%, standard deviation of 20%
b. Expected return of 2% standard deviation of 30%
c.Expected return of 5%, standard deviation of 30%
d.Expected return of 2% standard deviation of 20%

Answers

The portfolio with the lowest Sharpe ratio is Portfolio B with an expected return of 2% and a standard deviation of 30%.

A portfolio is a combination of stocks, bonds, and other investment types that may generate profits. The  Sharpe ratio evaluates the return of a portfolio compared to the risk-free rate.

The portfolio with the lowest Sharpe ratio is the one with the highest risk with no significant returns. Now let's look at the given options and identify the one with the lowest Sharpe ratio.

Suppose the risk-free rate is equal to 1%. Which one of the following portfolios has the lowest Sharpe ratio?

Portfolio A

Expected return = 5%

Standard deviation = 20%

Sharpe ratio = (5 - 1) / 20

                    = 0.20

Portfolio B

Expected return = 2%

Standard deviation = 30%

Sharpe ratio = (2 - 1) / 30      

                    = 0.03

Portfolio C

Expected return = 5%

Standard deviation = 30%

Sharpe ratio = (5 - 1) / 30

                    = 0.13

Portfolio D

Expected return = 2%

Standard deviation = 20%

Sharpe ratio = (2 - 1) / 20              

                    = 0.05

Therefore, the portfolio with the lowest Sharpe ratio is Portfolio B with an expected return of 2% and a standard deviation of 30%.

Learn more about portfolio from this link:

https://brainly.com/question/25929259

#SPJ11

The relationship between lung capacity and gender was studied in a laboratory investigation. Relative lung capacity was measured by having each student fill a balloon with a deep breath and then measuring the circumference of the balloon. Each student was given three trials and the average balloon circumference was recorded in the data table below.

The relationship between lung capacity and gender was studied in a laboratory investigation. Relative

Answers

According to the table given below the females reduced the airways diameter and the volume of lung result in the lower peak of expiratory flow and the vital capacity.

What is lung capacity?

Lung capacity is defined as the total volume of the air present in the lungs at different stages or phases of the whole respiratory cycle. 6 liters of air is the average lung capacity of an adult male. The expiratory reserve volume is the maximum volume of the air which has been exhaled from the end of the expiratory position.

Vital capacity is defined as the volume of the breather air deepest inhalation of breathened air.The expiratory reserve volume is the maximum volume of the air which has been exhaled from the end of the expiratory position.

Therefore, According to the table given below the females reduced the airways diameter and the volume of lung result in the lower peak of expiratory flow and the vital capacity.

Learn more about lung capacity here:

https://brainly.com/question/28004105

#SPJ1

Genes are the only factor affecting whether or not an individual will contract a disease. please select the best answer from the choices provided t f

Answers

It is false statement that; "Genes are the only factor affecting whether or not an individual will contract a disease. "

What is gene?

Genes are the units of inheritance located on the chromosomes. The total number of genes that an individual recieves from its parents is called the genotype of the individual.

While many illnesses may result from the genotypemof an individual, it is false statement that; "Genes are the only factor affecting whether or not an individual will contract a disease. "

Learn more about genotype: https://brainly.com/question/12116830

#SPJ4

Answer:

its false

Explanation:

paula uses an enzyme to speed up her chemical reaction

this is an example of which of the following biological molecules

carbohydrates
nucleic acids
proteins
lipids

Answers

proteins (:
proteins uses enzymes to speed up chemical reactions
carbohydrates is the answer

factor that changes as a result of changes in other variables

Answers

Answer:

dependent variables 2.independent variable .Explanation:

What makes something a compound microscope

Answers

Answer:

A compound microscope is an upright microscope that uses two sets of lenses (a compound lens system) to obtain higher magnification than a stereo microscope. A compound microscope provides a two-dimensional image, while a stereo microscope provides a three-dimensional image.  

Explanation:

COMPOUND MICROSCOPES are so called because they are designed with a compound lens system. The objective lens provides the primary magnification which is compounded (multiplied) by the ocular lens (eyepiece). ... Eyepieces are commonly 10x resulting in total magnifications of 40x to 1000x (Objective x Eyepiece).

Please help and no file
What is activity A title?

Count: Chromosomes 1 through 22 are called autosomes. Examine the karyotype you have created.
How many total autosomes do human cells have?
How do you know that it is a male karyotyping?
Compare: In the SIMULATION pane, make sure Subject A is selected. Click on and drag one of subject A’s chromosomes to the area labeled Identify. Use the arrows to compare the chromosome you picked with chromosomes 1 through 22 and also with X and Y.
Which chromosomes did you select

Please help and no file What is activity A title?Count: Chromosomes 1 through 22 are called autosomes.

Answers

Answer:

The correct answer is -

Activity is the study of human karyotype

There are 22 autosomes

The sex chromosome has one copy of the X chromosome and one copy of the Y chromosome.

Explanation:

Which of these is an example of a chemical change?
A. Setting a piece of paper on fire
B. Melting iron into a liquid
C. Dissolving salt in water
D. Breaking a piece of plastic in half
SUBMIT

Answers

A. Setting a piece of paper on fire

In what way are facilitated diffusion and active transport similar? Q1. Both occur in only one direction. Q2. Both move materials up a concentration gradient. Q3. Both require ATP. Q4. Both involve proteins in the cell membrane.

Answers

Active transport is the movement of materials against a concentration difference; requires energy

Facilitated diffusion is when molecules pass across the membrane through the cell membrane channels.

So it would be Q4. Both involve proteins in the cell membrane

According to Hobbes, why do humans participate in a social contract? Check all that apply.

Answers

Where are the choices ?

You only have to answer the first question. I will give brainliest to the best answer.

You only have to answer the first question. I will give brainliest to the best answer.

Answers

Answer:

The mushroom is composed of two parts, the above ground part, and the underground part. Each part has its unique function and purpose in the life cycle of a mushroom.

Spores

It is usually released into the air and falls on the ground to start the life cycle of the mushroom. Seeds that acts as the mushrooms reproductive system.

Stem

A soft branch is supporting the mushroom’s cap.

Gill

Located under the cap, it produces the spore of the mushroom.

Mycelium

This part of the mushroom serves as the breeding ground of smaller mushrooms to grow.

Hypha

The microscopic filament that draws water and the organic matter necessary for mushroom development.

Volva

The remnant of a membrane that completely covers the immature mushroom.

Ring

A covering located under the cap surrounding the stem.

Cap

The upper part of the mushroom that protects the gills. It usually resembles a headdress, hence its name.

Hope it helps!!!

Which equations are balanced? Select all that appl

Which equations are balanced? Select all that appl

Answers

Answer:

B

D

F

Explanation:

the characteristic of organisms being made up of cells

Answers

Energy

Explanation:

energy is the ability to change or move matter

Answer:

All living things

Explanation:

All living things, large or small, plant or animal, are made up of cells. Most living things are made up of one cell and they are called unicellular organisms. Many other living things are made up of a large number of cells that form a larger plant or animal. These living things are known as multicellular organisms. The first characteristic of a living thing is that they are made up of cells. A cell is the basic building block of all organisms. ... They contain the organism's hereditary information (DNA) and can make copies of themselves in a process called mitosis.

The graph shows one consequence of urban sprawl. How did urban sprawl
contribute to the change in biodiversity?

The graph shows one consequence of urban sprawl. How did urban sprawlcontribute to the change in biodiversity?

Answers

Urban Sprawl leads to reduced habitat and fragmentation. Option D

How does Urban Sprawl affect biodiversity?

Natural ecosystems are frequently destroyed and fragmented as a result of urban sprawl. Forests, marshes, and other habitats are destroyed when cities grow to make room for new structures, parking lots, and other infrastructure.

The remaining natural areas become fragmented as a result of habitat loss, isolating populations of plants and animals and interfering with their ecological connectedness. Fragmented ecosystems make it harder for species to migrate, reproduce, and obtain suitable resources, which causes biodiversity to dwindle.

Learn more about biodiversity:https://brainly.com/question/13073382

#SPJ1

Communities within ecosystems are established through the process of ____.

a. commensalism

b. parasitism

c. succession

d. symbiosis

Answers

Answer:

D

Explanation:

Answer is D 100% good luck

an intercalating agent such as aflatoxin is more likely to cause which type of mutation?

Answers

An intercalating agent such as aflatoxin is more likely to cause frameshift mutations.

Intercalating agents are molecules that can insert themselves between the DNA base pairs, causing disruptions in the DNA helix structure. Aflatoxin is a known intercalating agent that can be found in certain molds and can contaminate food, particularly grains and nuts.

When an intercalating agent like aflatoxin inserts itself into the DNA molecule, it can interfere with DNA replication and transcription processes. This interference can lead to mistakes during DNA replication or transcription, resulting in mutations.

One of the primary types of mutations induced by intercalating agents is frameshift mutations. Frameshift mutations occur when nucleotides are either inserted or deleted in the DNA sequence, shifting the reading frame of the genetic code. This can lead to a completely altered amino acid sequence during protein synthesis.

Intercalating agents have a greater likelihood of causing frameshift mutations because their insertion or deletion of nucleotides disrupts the reading frame, which can significantly impact the protein's structure and function.


To know more about okay, refer here:
https://brainly.com/question/12732356#
#SPJ11

reddish pigment in wheat kernels is an inherited trait. in crosses between wheat plants with different kernel colors, a wide range of kernel color phenotypes is observed among the offspring. what pattern of inheritance is suggested by the graph? incomplete dominance multiple alleles codominance polygenic inheritance

Answers

In this case, the pattern of inheritance suggested by the graph is incomplete dominance. The correct answer is option a.

What is incomplete dominance?

Incomplete dominance is a kind of inheritance in which one allele does not completely dominate over the other. Rather than completely overpowering the other allele, the two alleles combine to generate a new phenotype that falls somewhere between the dominant and recessive phenotypes.Example:Flowers of Mirabilis jalapa, known as the four-o'clock flower, are a great example of incomplete dominance.

Mirabilis jalapa comes in a variety of colors. When the red-flowered Mirabilis jalapa is crossed with the white-flowered Mirabilis jalapa, the F1 (first filial) offspring has pink flowers, which is a combination of the red and white flowers' alleles.Arrangement of genes on chromosomes determines multiple alleles. Codominance and polygenic inheritance are also different types of inheritance. The correct answer is option a.

To know more about incomplete dominance refer to-

brainly.com/question/14053639#

#SPJ11

Complete question

Reddish pigment in wheat kernels is an inherited trait. in crosses between wheat plants with different kernel colors, a wide range of kernel color phenotypes is observed among the offspring. what pattern of inheritance is suggested by the graph?

a. incomplete dominance

b. multiple alleles

c. codominance

d. polygenic inheritance

The diagrams show what happens to the shape of a plant cell place in distilled water. Explain why the cell swells and becomes turgid. Name the process involved.

Answers

Answer:

the name of the process should be osmosis

Explanation: Reason being that plant cells are hypertonic because they have a cell sap so when they are pout in distilled water  which is a hypotonic solution, it then absorbs water by osmosis and swells up and become turgid. But they do not burst because they have a cell wall that develops a wall pressure that balances the turgor pressure exerted by turgid cells

Why does the cycle that occurs during the AIDS stage of HIV infection cause increasingly severe symptoms ?

Answers

During the Guides phase of HIV disease, the insusceptible framework turns out to be seriously compromised, prompting a pattern of progressively extreme side effects. This cycle happens because of the accompanying elements:

Declining CD4+ Lymphocytes: HIV explicitly targets and obliterates CD4+ White blood cells, which assume a pivotal part in planning a safe reaction. As the infection duplicates and contaminates more CD4+ Lymphocytes, their numbers decline, debilitating the insusceptible framework's capacity to actually ward off diseases and sicknesses.

Pioneering diseases: With a debilitated insusceptible framework, people with Helps become defenseless to deft contaminations. These are contaminations brought about by organic entities that normally don't cause extreme disease in individuals with sound safe frameworks. Deft contaminations can go from bacterial, viral, parasitic, and protozoal diseases. These diseases can be extreme, relentless, and testing to treat, adding to the deteriorating of side effects.

Industrious aggravation: Persistent safe actuation and irritation are signs of HIV contamination. The continuous insusceptible reaction and aggravation further harm the safe framework and imperative organs after some time. This tireless irritation can prompt the advancement of unexpected complexities, like cardiovascular illness, neurological issues, and certain malignant growths, which add to the movement of side effects.

HIV transformations and viral variety: HIV has a high change rate, prompting the improvement of viral variations that can dodge the safe framework and antiretroviral treatments. As the infection advances, it turns out to be harder to control and treat, adding to the deteriorating side effects and treatment challenges.

Generally speaking, the pattern of progressively extreme side effects during the Guides phase of HIV contamination is driven by the dynamic obliteration of the safe framework, powerlessness to shrewd contaminations, persevering aggravation, and viral changes that compromise the body's capacity to protect against contaminations and illnesses.

Read more about AIDS progression at:

https://brainly.com/question/15604048

capillary refill time is most reliable as an indicator of end-organ

Answers

Capillary refill time indicates end-organ perfusion and can be used as an indicator in shock, dehydration, peripheral artery disease, hypothermia, and sepsis. To assess, apply pressure and release. A normal time is less than 2 seconds; prolonged time indicates poor perfusion.

Capillary refill time can be used as an indicator in a variety of conditions, including:

1. Shock: A decrease in capillary refill time may indicate hypovolemic, cardiogenic, or distributive shock.

2. Dehydration: Capillary refill time is often prolonged in dehydrated individuals due to decreased blood volume.

3. Peripheral artery disease: Reduced blood flow to the extremities may result in delayed capillary refill time.

4. Hypothermia: In cold temperatures, peripheral vasoconstriction may cause a delay in capillary refill time.

5. Sepsis: In severe sepsis, capillary refill time may be prolonged due to poor perfusion.

To assess capillary refill time, apply pressure to a fingertip or toenail bed and release it. The normal capillary refill time is less than 2 seconds. A prolonged capillary refill time may indicate poor perfusion and may warrant further evaluation.

For more such questions on Capillary refill , click on:

https://brainly.com/question/29832716

#SPJ11


What was the experimental variable we tested in the lodine Clock Reaction?

Answers

Answer:Experiment 1084-04: lodine Clock Reaction Purpose Determine the rate law for an iodine clock reaction and study the influence of st on that reaction abruptly that it can be as startling as the sudden sound of an alarm clock, hence the clock reaction Background Information chemical equations can be written for chemical reactions, only some will proceed while others do not. Among the ones that do proceed some reactions occur as soon as reactants are mixed, while others occur over minutes, hours, or n over several years. What are the controlling in predicting if a reaction will take place and the speed at which it will? Thermodynamics can answer the question, "Will the reaction take place?" Once the reaction is capable of proceeding kinetics can answer the other question, "How fast You will study the rate of the reduction of potassium persulfate, KoS Os, with sodium iodide, Nal. The net ionic equation for the reaction is eve The rate law for this reaction is in the form of And you will need to determine the reaction orders a and b, as well as the rate constant, k. Keep in mind that exponents can not be determined by jus looking at the chemical equation the reaction will take place? The rate of a reaction is defined as the increase in molar concentration of product of a reaction per unit time or the decrease in molar concentration of reectant per unit time. The usual unit for the rate is moles per liter per sec (mol/L s or M/s). Experimentally, it has been found that a reaction rate depends on the concentrations of the reactants. Usually a higher reactant concentration increases chance of collision among the reactants per unit time causing a faster reaction rate. An equation describing the relationship between the reaction rate and the concentration of the reactants You will need a way to determine how much of the reactants were spent over the given time period. Preferably, the concentrations of the reactants should not change too much; therefore the reaction rate can be represented by the initial concentrations of reactants (the initial-rate method). In this experiment, we will couple another reaction that consumes the product, 12 very quickly. The new reaction is the reduction of is called a rate law. For the elementary reaction Note that l2, which was produced in reaction (1) is consumed as fast as it is produced by reaction (2) to regenerate two l. i.e. [门is kept constant. By keeping [S203-9 much smaller than the initial concentration of S,0, we can assure [S20,1 is also kept nearly constant when S203 is completely consumed. At this point, the 12 is no longer eliminated by the reaction and starts to accumulate. This point is signaled by sudden appearance of the dark color from the interaction of l2 with starch indicator. We can measure the time elapsed till the color appears Rate k [AIB] The proportionality constant, k, is called the ate constant in the relationship between the rate nd concentrations. The rate constant has a fixed alue as long as the reaction temperature is held nstant. The exponents, a and b, are called the action order, and are frequently, but not always, egers. More importantly, they must be termined experimentally In this experiment you will determine the rate an iodine clock reaction, and study the effects of perature and a catalyst to the reaction rate ugh there are several versions of an iodine k reaction, all of them share a common feature: completion of the reaction is signaled by the en appearance of a dark purple color. This is characteristic of the interaction between cular iodine and starch. When the reaction is ed out correctly, this color will appear so According to the reaction stoichiometries of reactions (1) and (2), two molecules of S203 are required to counteract the consumption of one molecule of S20a2. Since S2032 would have been completely consumed when the dark purple color appeared, the Δ[SO ] should be % of the initial concentration of S203 15-08-2] = ½ initial [S,03-21

define bicarpellary​

Answers

Answer: adjective. Botany (of an ovary) having two carpells.

Other Questions
Suppose y varies directly with x, and y = 40 and x = 5 What is the value of y when x = 2? p and q are integers and p*q denotes the remainder when the product pq is divided by 10. Find a value p, greater than 4, such that p*p = (8*p) + 3 how psychology has its roots in philosophy, and provide examples of two philosophers contributions. When should a code for signs and symptoms be reported? Refer to ICD-10-CM guidelines I.C.18.a and I.C.18.b. Please help with this question. Im struggling a little bit A galaxy 100 megaparsecs from the Earth has a redshift roughly how much larger or smaller than a galaxy at 200 megaparsecs? Select one alternative:O A. Twice as big.O B. Four times as big.O C. It is impossible to say without knowing what kind of galaxies these are.O D. One quarter as big.O E. One half as big. How many types/kinds of grammar are there, and what are they?. Explain why subsistence farmers are more vulnerable to fires than commercial farmers electrons can only gain energy by leaving the atom (creating an ion). electrons move between discrete energy levels, or escape the atom if given enough energy. electrons can have any energy below the ionization energy within the atom, or escape if given enough energy. electrons can have any energy within the atom, and cannot be given enough energy to cause them to escape the atom. electrons move between discrete energy levels within the atom, and cannot accept an amount of energy that causes them to escape the atom. 5 points saved question 7 the spectrum from an incandescent (with a filament) light bulb is a(n) continuous spectrum. emission line spectrum. absorption line spectrum. why are antibiotics unhelpful for treating the common cold? Depression that goes untreated can cause a person to have clouded thinking and develop into what is called __________. 4(v + 7) = -6(3v - 4) +8v An option valuation model predicated on the assumption that stock prices can move to only two values over any short time period is called binomial model.a. Trueb. False What scope does procurement/purchasing have in the supply chain?(i.e. what supply chain members are stakeholders. E.g.manufacturers, warehouses etc.) The number of members f(x) in a local swimming club increased by 30% every year over a period of x years. The function below shows the relationship between f(x) and x:f(x) = 10(1.3)xWhich of the following graphs best represents the function? (1 point)a Graph of f of x equals 1.3 multiplied by 10 to the power of xb Graph of exponential function going up from left to right in quadrant 1 through the point 0, 0 and continuing towards infinityc Graph of f of x equals 10 multiplied by 1.3 to the power of xd Graph of f of x equals 1.3 to the power of x the bagpipe, which became a marker of scottish identity only in the late seventeenth century, is an example of an: After heavy exercise, if energy reserves in a muscle are depleted, ________ occurs.A. treppeB. paralysisC. atrophyD. tetanusE. an oxygen debt HELP ME QUICK Solve for w.P=2w + 2t The nonvolatile, nonelectrolyte urea, CH4N2O (60.10 g/mol), is soluble in water H2O. Calculate the osmotic pressure generated when 12.3 grams of urea are dissolved in 240 ml of a water solution at 298 K. The length of a rectangular frame is represented by the expression 2x 8, and the width of the rectangular frame is represented by the expression 2x 6. write an equation to solve for the width of a rectangular frame that has a total area of 160 square inches. 4x2 32x 48 = 0 4x2 28x 112 = 0 2x2 32x 112 = 0 x2 12x 48 = 0