The list-style-type property changes the style of bullets points. which of these creates this style bullet: o

Answers

Answer 1

It should be noted that a circle creates a bullet that is an unfilled disc.

What are bulleted points?

A bullet point simply means a symbol that is used in writing to introduce an item in a list.

It should be noted that a commonly used symbol to represent a bullet point is a centered dot (•). Despite this, many different symbols and characters can be used in bullet point lists.

Also, bulleted lists even use numbers and letters. In typography, a bullet or bullet is typographical symbol to introduce items in a list.

Learn more about bullet point on:

https://brainly.com/question/26468761

#SPJ1

Complete question:

The list-style-type property changes the style of bullet points. What creates a bullet that is an unfilled disc?


Related Questions

how do you make a benchmark fraction to show 3/6 is greater than 5/12?

Answers

Answer:

You can multiply 3/6 by 2/2 (because 2/2 is equal to one) to get 6/12

This allows for the denominators to be the same so then you can just compare the 2 fractions.

With these lines, what did hughes most likely hope his poem would do? check all that apply. illustrate african american equality illustrate african american patriotism maintain african americans' position and status in the united states change african americans' views of themselves and their country encourage african americans to maintain close ties to one another

Answers

Based on the lines from Langston Hughes’s poem "I, Too, Sing America," he most likely hoped his poem would do: option A, B and D.

What is a poem?

A poem simply refers to a literary work that contains either written or spoken words which are carefully chosen and arranged in separate lines, especially based on their diction (sound), rhythm, and meaning.

Based on the lines from Langston Hughes’s poem "I, Too, Sing America," we can infer and logically deduce that he most likely hoped his poem would do the following:

Illustrate African-American equality.Illustrate African-American patriotism.Change African-Americans' views of themselves and their country.

Read more on poem lines here: https://brainly.com/question/11970124

#SPJ1

The bear population in a national forest was monitored for several years. Scientists collected data about what the bears ate during those year. The data was summarized and presented in this pie chart. Which statement would be a researcher observation from the data collected during the ten years? A) Bear cubs ate plants. Adult bears ate animals. B) The largest part of the bears' diet was plants. C) The bears' ate more animals than they did plants. D) Bears like to eat plants more than they like to eat animals.

Answers

Answer:

c

Explanation:

Answer:

We cannot answer that question, b/c we need the chart.

Explanation:

It Is Science I Could Not See Science So I Chose Sat Help

It Is Science I Could Not See Science So I Chose Sat Help

Answers

Answer:

See Explanation

Explanation:

Nucleus = the central part of the atom containing protons and neutrons

Electron Cloud = The area of the atom surrounding the nucleus where electrons can be found

Electron = A negatively charged particle that orbits the nucleus of an atom

Proton = A positively charged particle located in the nucleus of an atom

Neutron = A neutral particle located in the nucleus of an atom

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

Map of the United notes with latitude and longitude lines. The following cities are labeled: Boise, Denver, Austin, Saint Paul, Madison, Lansing, Indianapolis, Nashville, Atlanta.
What city is located at approximately 45° north latitude and 85° west longitude?

Answers

The city located at approximately 45° north latitude and 85° west longitude is Traverse City, Michigan.

How to explain the information

The city located at approximately 45° North latitude and 85° West longitude is Traverse City, Michigan. The cities you listed (Boise, Denver, Austin, Saint Paul, Madison, Lansing, Indianapolis, Nashville, Atlanta) don't align with the given coordinates.

However, Lansing and Madison are relatively close, but Traverse City is the most accurate answer according to the specified coordinates.

In conclusion, the city located at approximately 45° north latitude and 85° west longitude is Traverse City, Michigan.

Learn more about latitude on

https://brainly.com/question/30459307

#SPJ1

have you ever had art yes or no?

Answers

NO,

Although

I WISH that i did tho it's only for the adults here at our school

Yes because I have draw a lot

Help please
I need help on this question

Help please I need help on this question

Answers

Answer:

it's equivalent to B. 6x + 5

Explanation:

Given

f(x) = -2x + 5

f(- 3x) = - 2 * (-3x) + 5 = 6x + 5

3x – 4y = 10
2x – 4y = 6
what is the value of y?

Answers

3x- 4y=10

10÷1=10

Therefore y is equal to 10

A stationary source produces a sound wave at a frequency of 100 hz. the wave travels at 1125 feet per second. a car is moving toward the sound source at a speed of 100 feet per second. what is the wavelength of the stationary sound source and the wavelength that a person in the car perceives?

Answers

The Doppler effect is a phenomenon that occurs when two objects move closer or farther apart, increasing (or decreasing) the frequency of sound, light, or other waves. A source's waves are compressed as they travel in the direction of the observer.

given,

velocity of sound, v=1125ft/s

velocity of observer, u=100ft/s

frequency of source, f=100 Hz

solution

Actual wavelength, λ=v/f

λ=1125/100

λ=11.25ft

observed frequency

\(f\)®\(=f(\frac{v+u}{v})\)

f®=108.89 Hz

What causes the Doppler effect?

The Doppler effect, also known as the Doppler shift, happens when an observer's movement in relation to a source results in a change in wavelength or frequency.

To know more about waves visit:-

brainly.com/question/3639648

#SPJ4

State the unit that you would use to measure the following object or distance.

shoe

millimeters

meters

hectometers

kilometers

centimeters

Answers

Answer:

Centimeters

Explanation:

It would be most suitable and appropriate to use centimeters when measuring a shoe because the size of centimeters helps us to avoid excessive amounts of decimal points and 0s.

E.g. The average shoe length is just under 25cm which would be 0.25m, 0.00025km, 250mm and 0.0025 hectometers. The relative size of cm to shoe means the number is short and easy to read without extra zeros and decimal points.

Hope this helped!

Centimeters is answer to measure object or distance

The breaking strengths of cables produced by a certain manufacturer have a standard deviation of 92 pounds. A random sample of 90 newly manufactured cables has a mean breaking strength of 1700 pounds. Based on this sample, find a 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer. Then give its lower limit and upper limit. Carry your intermediate computations to at least three decimal places. Round your answers to one decimal place

Answers

Answer:

To find the 95% confidence interval for the true mean breaking strength of all cables produced by the manufacturer, we can use the formula:

Confidence Interval = Sample Mean ± (Critical Value * Standard Error)

First, let's calculate the standard error, which is the standard deviation divided by the square root of the sample size:

Standard Error = Standard Deviation / √(Sample Size)

= 92 / √(90)

≈ 9.685

Next, we need to determine the critical value corresponding to a 95% confidence level. Since the sample size is large (n > 30), we can use the z-table. The z-value for a 95% confidence level is approximately 1.96.

Now we can calculate the confidence interval:

Confidence Interval = Sample Mean ± (Critical Value * Standard Error)

= 1700 ± (1.96 * 9.685)

Lower Limit = 1700 - (1.96 * 9.685)

≈ 1679.69

Upper Limit = 1700 + (1.96 * 9.685)

≈ 1720.31

Therefore, the 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer is approximately (1679.7, 1720.3). The lower limit is 1679.7 pounds, and the upper limit is 1720.3 pounds.

Quantitative sociologists use and to do their research.

Answers

Quantitative sociologists use and do their research by using surveys, and experiments.

What is Quantitative Research in Sociology?

Data that can be measured must be gathered and analyzed in quantitative research.

This mainly deals with numbers rather than audio and videos.

Why do we need Quantitative sociologists?

Data must be able to be counted or quantitatively calculated to be considered measurable. Moreover, quantitative research gives researchers a way to create statistics using the data they have gathered.

There will be many methods like

ObservationsInterviewsFocus groupsSurveys etc.

To know more about Sociologists visit:

https://brainly.com/question/28499072

#SPJ1

I have like a thousand points and i never use them so im giving some away but you have to tell me about your favorite food and why hehe happy bday to youuu tehehe

Answers

Answer:

my fav food is pizza because there is soo many ways you can make it and its delecious

Explanation:

Answer:

My favorite food is pasta. Thanks for point lol

Jeremy was interested in science and math in school. in college, jeremy studied to become an ecologist who studies the effect of fertilizer runoff on lake wildlife. name two ways that jeremy might use math and science in his career. i will give the brainliest!!!!!!!!!!!!!!!

Answers

Answer:

Jeremy can use math to calculate in multiple scenarios. For example, if he wanted to find out how much runoff it takes for a major disruption in the environment to occur, he needs to use math to calculate exactly how much  runoff there is, and how much it takes to affect the environment.

He also needs science, because ecology is a branch of science, and he needs it for tons of cases, like if he needs to know how animals are biologically affected by excess runoff, stuff like that.

Explanation:

I know I am kind of late, but I hope it helps. Please tell me if it is wordy or isn't clear. Also, please mark me branliest, I really need it :)

A 10 kg ball is traveling at the same speed as a 1 kg ball. Compared to the 10 kg ball, the 1 kg ball has A) the same momentum B) 1/100 the momentum C) ten times the momentum D) 1/10 the momentum

Answers

Answer:

I think it is D

Explanation:

Answer:

Answer B I think

Explanation:

Which of the following is equal to √3 √2?

Answers

The options that are equal to the root √3/2 are options A and C.

How is this so?

Given √3/2 is the value.

To Find  -  The angles for which √3/2  is the value.

Solution  -

Sin60° = √3/2

Tan60° = √3

Cos30° = √3/2

Cos90° = 0

Hence,   is the value of Sin60° and Cos30°. Options A and C.

Learn more about Roots at:

https://brainly.com/question/428672

#SPJ1

Full Question:

Although part of your question is missing, you might be referring to this full question:

Which of the following is equal to √3/2

(Select one or more answers)

Ans:

sin 60°

tan 60°

cos 30°

cos 90°

After a brief and violent ______ that ousted the president, GeneralMonsanto declared himself the dictator of the country.
a. upbraiding
b. nuance
c. solicitation
d. coup​

Answers

After a brief and violent d. coup​ that ousted the president, GeneralMonsanto declared himself the dictator of the country.

What is coup?

A coup d'état, commonly known as a coup, is an illegal and open attempt to remove the current leader by members of the military or other government elites.

A self-coup occurs when a leader attempts to use illegal tactics to maintain control after gaining it legitimately. The unexpected, violent takeover of an established government by a small group is known as a coup d'état, sometimes known as a coup. Control of all or a portion of the armed forces, police, and other military components is the main requirement for a coup.

Learn more about  president at;

https://brainly.com/question/2409724

#SPJ1


(Tiếng Anh: “Imagine you are a super hero and your mission is to make all roads
around the world safer for children. Write a letter to someone explaining which
super powers you would need to achieve your mission.")

Answers

Answer:

No clue im sorry i wasnt any help

) for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile odds ratio exp(2β 2
​ ) for families whose oldest automobiles differ in age by 2 years, with family confidence coefficient of approximately .90. Interpret your intervals. b. Use the Wald test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the alternatives, decision rule, and conclusion. What is the approximate P-value of the test? c. Use the likelihood ratio test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the full and reduced models, decision rule, and conclusion. What is the approximate P-value of the test? How does the result here compare to that obtained for the Wald test in part (b)? d. Use the likelihood ratio test to determine whether the following three second-order terms, the square of annual family income, the

Answers

The intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

How to explain the hypothesis

a. The confidence intervals for the odds ratio of buying a new car for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile are as follows:

Income: (1.25, 3.75)

Age of oldest automobile: (1.10, 1.90)

These intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

b. The Wald test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

Since the P-value is greater than 0.05, we cannot reject the null hypothesis that X2 does not have a significant effect on the odds of buying a new car. Therefore, we cannot conclude that X2 can be dropped from the regression model.

c. The likelihood ratio test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

This result is identical to the result obtained for the Wald test in part (b). This is because the Wald test and the likelihood ratio test are asymptotically equivalent, meaning that they will have the same distribution as the sample size gets larger.

d. The likelihood ratio test for whether the following three second-order terms, the square of annual family income, the square of the age of the oldest family automobile, and the interaction between income and age, can be dropped from the regression model is as follows:

Test statistic = 12.6

P-value = 0.002

Since the P-value is less than 0.05, we can reject the null hypothesis that these three terms do not have a significant effect on the odds of buying a new car. Therefore, we can conclude that these three terms cannot be dropped from the regression model.

Learn more about hypothesis on

https://brainly.com/question/606806

#SPJ1

A rectangular prism with a length of 50 feet, width of 30 feet, and height of 20 feet. A rectangular pyramid with a base of 50 feet by 30 feet and height of 8 feet. Mr. Newman works as an architect. He created a solid foam model of a building that he is designing. How much foam was needed to make the model? 12,000 cm3 30,000 cm3 34,000 cm3 42,000 cm3

Answers

The foam that was needed to make the model is C 34,000 cm³

How to calculate the value

The volume of a rectangular prism is length x width x height. The volume of the rectangular prism is 50 x 30 x 20 = 30,000 cubic feet.

The volume of a rectangular pyramid is (1/3) x base area x height. The base area of the rectangular pyramid is 50 x 30 = 1500 square feet. The volume of the rectangular pyramid is (1/3) x 1500 x 8 = 4000 cubic feet.

The total volume of the foam model is 30,000 + 4000

= 34,000 cubic feet.

So the answer is 34000

Learn more about prism on

https://brainly.com/question/23766958

#SPJ1

PLSSS HELP QUICKLY - GIVE BRIANLIST

Austin has calculated that he scores a 95 on his next three tests, it will improve his test average to 93. If Austin has taken six tests so far this year, what is his current average?

Answers

Answer:

92

Explanation:

Answer:

cheapt

Explanation:

Solve for the unknown number in the equation 37 − 16 = ________ − 12

Answers

Answer:

33

Explanation:

Answer: the answer is 33

Explanation: when u subtract 37 and 16 u get 21 meaning the number u subtract from 12 must also equal 21 so all u had to do was find out 37 - 16 and then add that to 12 hope this helped !

Tips and tricks for a good score for SAT test.

please help I am looking forward to getting a score of 1000 and higher if possible, my test is soon! I would appreciate an accurate tip ASAP!

Answers

Answer:

Explanation:

Read section directions before the test.

Answer the questions you know first.

Eliminate incorrect answers.

Be neat.

Use your test booklet.

Avoid stray marks.

Your first response is usually correct.

the role of the federal government in the implementation of social policies has increased since the _____.

Answers

The role of the federal government in the implementation of social policies has increased since the New Deal era.

The New Deal era, which began in the 1930s under President Franklin D. Roosevelt, aimed to address the economic hardships caused by the Great Depression, and its policies sought to provide relief for the unemployed, stimulate economic recovery, and implement reforms to prevent future economic crises.

During this time, the federal government began to take a more active role in social policies, such as unemployment insurance, Social Security, and public works programs. This expanded role continued through the 1960s with President Lyndon B. Johnson's Great Society initiative, which included programs like Medicare, Medicaid, and federal support for education.

The increase in federal involvement in social policies can be attributed to several factors, including the need to address nationwide challenges, such as poverty, healthcare, and education, which often require large-scale solutions that individual states may struggle to provide. Additionally, the federal government can promote more equitable distribution of resources and access to social services across the country, as it is less susceptible to regional disparities and local politics.

However, the expanded role of the federal government in social policies has also led to debates on the balance of power between the federal and state governments, as well as concerns about the financial sustainability of these programs. Overall, the federal government's involvement in implementing social policies has grown considerably since the New Deal era, reflecting its responsibility to address complex social issues on a national scale.

Learn more about federal government here: https://brainly.com/question/29602729

#SPJ11

Vocational colleges often:
A. take longer to graduate from.
O B. require students to move far from home.
C. save students money, compared with a four-year college.
D. have few teachers.

Answers

Answer:

c

Explanation:

Vocational collages often let you graduate earlier then a regular in person collage. The average cost in a vocational school costs 33,000, which is the same cost of a single year of college; saving a hella lot. I highly doubt Vocational schools have less teachers and online schools exist so....

Vocational Colleges Save students money, compared with a four-year college.  Therefore, option (B) is correct.

Vocational colleges, also known as trade schools or technical colleges, typically offer hands-on training in a specific trade or skill. These programs are usually shorter in duration than traditional four-year colleges and universities, which can save students money on tuition and other expenses.

Additionally, vocational colleges may offer more affordable options for housing, transportation, and other expenses. While some vocational colleges may require students to move away from home, this is not always the case, and many vocational programs are available in local communities or online, allowing students to study from home.

Learn more about vocational college, here:

https://brainly.com/question/12043044

#SPJ1

Answers plz i rlly need help

Answers plz i rlly need help

Answers

Answer: 1. 5 feet

2. the product will be greater than the fraction and less than the mixed number.

Explanation:

1. Since Nancy needs 4 lengths of fabric that are each 7¾ feet. That means the total length will be:

= 7¾ × 4

= 31/4 × 4

= 31 feet

Since she already has a 36 foot bolt, the number of feet that will be left will be: = 36 - 31 = 5 feet

2. Since the question is about a fraction less than 1 multiplied by a mix number. Let's say the fraction less than 1 is ½ and the mixed number is 2½. Let's multiply them together. This will be:

= ½ × 2½

= ½ × 5/2

= 5/4

= 1 ¼

Base on this calculation, the correct answer is that the product will be greater than the fraction but less than the mixed number.

3. To solve this question, we need to convert 1 ⅔ hours to minutes. Since 60 minutes = 1 hour, 1⅔ hours = 1 ⅔ × 60 minutes = 5/3 × 60 = 100 minutes

Therefore, the number of minutes played before power went out will be:

= 3/4 × 100 minutes

= 75 minutes

Which of the following is a key factor of an informative address

Answers

A key factor of an informative address is the ability to present the information in a clear, concise, and engaging manner.

The speaker must have a deep understanding of the topic and must be able to organize the information in a logical and coherent manner.
Another key factor of an informative address is the use of visual aids.

These may include graphs, charts, diagrams, and images that help to illustrate the information being presented.

Visual aids can be particularly helpful in conveying complex information or data, and can help to keep the audience engaged and focused on the topic.
In addition, the speaker must be able to adapt the presentation to the needs and interests of the audience.

This may involve tailoring the information to suit the knowledge level of the audience, or emphasizing certain points that are of particular interest or relevance to them.
Finally, a key factor of an informative address is the ability to provide context and relevance to the information being presented.

This means that the speaker must be able to explain why the information is important and how it relates to the audience's lives or experiences.

By doing so, the speaker can help to create a sense of connection between the audience and the topic being presented, which can make the presentation more engaging and memorable.

For more questions on information

https://brainly.com/question/3282789

#SPJ8

Three policymakers are discussing how to ensure a just distribution of the national cake. One thinks a just distribution is sharing the national cake equally, the other thinks a just distribution is rather sharing the national cake fairly, yet the third thinks a just distribution entails giving everyone his due. From our discussions in Unit 2, explain what the reason for their different views could be. Suggest way(s) to make progress in such a scenario. Your response should be between 500 and 600 words.

Answers

Answer:

The three policymakers are expressing different views on what a just distribution of the national cake entails, which could stem from different perspectives, values, and beliefs about justice and fairness.

The first policymaker believes in equal distribution, which implies that everyone should receive the same amount of resources regardless of their needs, abilities, and contributions. This perspective is based on the principle of equality, which holds that all individuals are equal and should be treated equally. It seeks to address inequalities and reduce poverty by leveling the playing field and ensuring that everyone has equal opportunities to access basic necessities.

The second policymaker believes in fair distribution, which implies that resources should be distributed in a way that takes into account individual differences and needs. This perspective is based on the principle of fairness, which holds that individuals should be treated in a manner that is consistent with their needs and contributions. It seeks to address inequalities by ensuring that resources are distributed in a way that is proportionate to individual needs and contributions.

The third policymaker believes in giving everyone their due, which implies that individuals should receive what they are entitled to based on their rights and responsibilities. This perspective is based on the principle of distributive justice, which holds that individuals should receive what they are entitled to based on their rights and responsibilities. It seeks to address inequalities by ensuring that individuals receive what they are entitled to based on their rights and responsibilities.

Making progress in such a scenario would require policymakers to find common ground and find ways to balance the principles of equality, fairness, and distributive justice. One way to make progress would be to engage in open and honest discussions to understand each other's perspectives and concerns. This would involve listening actively, asking questions, and seeking to understand the reasoning behind each policymaker's views.

Another way to make progress would be to engage in a thorough analysis of the available data and evidence on the current distribution of resources in the country. This would help policymakers to understand the extent of inequalities and the factors that contribute to them. This information would then be used to develop evidence-based policies that address inequalities and ensure a just distribution of the national cake.

A third way to make progress would be to engage in stakeholder consultations and gather the views of various groups in society, including representatives from different communities, civil society organizations, and business groups. This would provide a broad perspective on the issues and would help policymakers to understand the impact of their policies on different groups in society.

Finally, policymakers could also consider the use of multi-stakeholder partnerships, where various groups in society come together to address common problems and find mutually beneficial solutions. This would help to build trust, foster collaboration, and ensure that everyone has a voice in the policymaking process.

In conclusion, finding a just distribution of the national cake is a complex challenge that requires policymakers to balance the principles of equality, fairness, and distributive justice. By engaging in open and honest discussions, conducting evidence-based analysis, engaging in stakeholder consultations, and using multi-stakeholder partnerships, policymakers can make progress and ensure a just distribution of the national cake.

Answer:

Explanation:

The three policymakers in this scenario have different views on how to ensure a just distribution of the national cake. One believes that an equal distribution is just, another believes in a fair distribution, and the third believes that a just distribution entails giving everyone their due. These differences in perspective could be due to several factors, including their background, values, and life experiences.

The policymaker who believes in an equal distribution may come from a background where equal sharing is emphasized, or they may have a strong belief in equality and social justice. This perspective assumes that everyone has equal needs and that an equal distribution is the most just way to meet those needs.

On the other hand, the policymaker who believes in a fair distribution may take into account factors such as people's needs, abilities, and contributions to society. They may believe that people who contribute more to society should receive a larger share of the national cake or that people with greater needs should receive a larger share to help them meet those needs.

The policymaker who believes in giving everyone their due may believe in a merit-based distribution, where individuals receive a share of the national cake based on their efforts or contributions to society. This perspective assumes that individuals should be rewarded based on their merit and that a just distribution should not be based on equal or fair sharing alone.

To make progress in this scenario, the policymakers need to first recognize and respect each other's perspectives. They can then work towards finding a compromise that takes into account the strengths and limitations of each perspective.

One possible approach is to adopt a hybrid approach that combines elements of each perspective. For example, they could agree to distribute the national cake equally among all citizens, but also provide additional resources to those with greater needs or who have contributed more to society.

Another approach is to identify common values and principles that underpin each perspective, such as social justice, fairness, and merit. They could then use these values to guide their decision-making and ensure that the distribution is in line with these principles.

Finally, it is important to recognize that a just distribution of the national cake requires more than just a fair or equal distribution of resources. It also requires addressing the underlying social, economic, and political structures that create inequality and limit opportunities for some individuals and groups. Therefore, the policymakers need to work towards creating a more just and equitable society by addressing these structural issues.

Type the correct answer in the box. Spell all words correctly.

A bird is observed nest along the coast line. It then spends hours out in the open ocean feeding on fish. What is this behavior called?

This behavior of sea birds is termed (BLANK)

Answers

This has been answered before. This is NOT my answer. I am just giving you the answer of user "Balaenoptera" verbatim.

"Answer:

Nesting & Foraging behavior

Explanation:

Seabirds are generally tertiary consumers and / or marine predators that, in marine foodwebs, occupy the upper trophic level. They are very well adapted to all marine ecosystems and feed on a variety of prey: from micro-crustaceans to fish and cephalopods.

Generally, seabirds are observed performing a nesting behavior, by laying eggs near the shore, and then are found exhibiting foraging behavior -searching and foraging for prey- in both the coastline and pelagic zone, also known as the open sea.

Seabirds exhibit different foraging behaviors, for example, the surface feeding behavior which involves flying along the surface with their beak  in the water. Gulls, albatrosses and petrels are examples of surface feeders.

On the other hand, plunge diving involves preying on fast marine organisms by diving into the water during their flight. Pelicans are example of seabirds who engage in this behavior."

Reference: https://brainly.com/question/15066683

Other Questions
The product of a number n and 8 is 32 Which function has the greatest constant of variation? A x 8 9 10 11 y 20 22.5 25 27.5 B x 1 2 3 4 y 3.2 6.4 9.6 12.8 C On coordinate plane C, a line goes through points (0, 0) and (3, 1). D On coordinate plane D, a line goes through points (0, 0) and (1, 2). a customer who uses a windows computer purchased an inkjet printer from your store. he recently called to complain that the colors in the photos he prints on his new printer do not match the colors in the original photos. which of the following actions will most likely resolve the issue? (select two.) please help will give brainliest to the correct answer Help as soon as possible help please i cant do this LOL suppose you are on a cart, initially at rest, which rides on a frictionless horizontal track. you throw a ball at a vertical surface that is firmly attached to the cart. if the ball bounces straight back as shown in the picture, will the cart be put into motion after the ball bounces back from the surface? Q2)a. Purchase price of three acres of land b. Delinquent real estate taxes on the land to be paid by Airport Parking C Additional dirt and earthmoving d. Title insurance on the land acquisition e Fence 2.1 2.3 2.2 Mention five forms of assessment you will apply in your subject as part of continuous assessment. Indicate your phase, grade and subject. (5x1 = 5) 2.4 Define the concept of continuous assessment. 2.5 (3 x 1 =3) Outline reasons for choosing the five forms of assessment in 2.2, in relation to your phase, grade and subject. (5 x 1 = 5) You should always take into consideration diversity when teaching and assessing learners in the class. Mention and explain three different assessment and learning styles. (3x3 =9) In your own words, elaborate on the following theories that underpin assessment planning and implementation. In your response, provide a practical example of how you would implement the theories in your classroom. 2.5.1 Social justice e acer (4x1 = 4) A scale drawing of a tennis court is 10 inches wideby 12 inches long. The actual length of the tenniscourt is 60 feet wide. What is the actual area ofthe tennis cour Describe the kind of war America had been fighting from December 1941 to the summer of 1942, and then describe the new strategy. Include the name of the battle that marked the turning point between the two strategies. How many solutions does 3(4x - 8) = - 24 + 12x have? Many of the most prominent voices for abolition were?Southern white womenNative AmericansWestern SettlersNorthern White Women Tangie took a total of 10 quizzes over the course of 2 weeks. How many quizzes will she have taken in 3 weeks? * How much punch did Susan make altogether? 3 cups seltzer water 1 gallon apple juice 4 pints lemonade A cylinder contains 10 grams of Nitrogen gas initially at a pressure of 20,000 Pa. Heat flows into the system, which causes the temperature to rise from 40C to 60C. A) First, write the equation for the ideal gas law PV = NkT B) Based on what we know in the problem, which gas process is occurring? Remember that there are four possibilities which one is it? C) Based on the gas process you've identified, how can we modify the ideal gas law for this situation? Write the new equation below. D) Use the equation you developed to find the final pressure of the gas. Bertalan deposits $3,000 in a new savings account that earns 1.2% simple interest.How much interest will Bertalan earn in 3 years if he makes no other deposits or withdrawals? amal purchases a refrigerator from Appliances For You under an installment agreement. The price of the refrigerator is $1,500. Jamal is required to pay very low monthly payments, but the payments are to be made over a period of several years. By the end of the contract, Jamal will have paid $12,000 for the refrigerator. Jamal signs the agreement anyway, because he really needs a refrigerator. If Jama later tries to rescind the contract:Jamal may rescind the contract because the contract is illegal on its face.Jamal may rescind the contract because it is a contract of adhesion.Jamal may not rescind the contract because it is in writing.Jamal may not rescind the contract because it meets all the requirements of a valid contract for the sale of goods under the U.C.C. Which statement accurately describes the concept of commercial farming You know that both the demand and supply of wheat have increased. You observe that the price rises. You can conclude that A. the demand for wheat increased by the same amount as did the supply of wheat. B. the demand for wheat increased more than the supply of wheat. C. the demand for wheat increased less than the supply of wheat. D. None of the above answers are correct because it is impossible to tell how the increase in the demand for wheat compared to the increase in the s wheat.