is the following definition of supplementary reversible

Answers

Answer 1

Answer:

Supplementary angles are two angles whose measures sum to 180°.

Explanation:


Related Questions

y = x^2 - 5x + 3
5x + y = 39
Which of the following is the x-value of a solution to
the system of equations above?
A) 6
B) 12
C) 18
D) 36

Answers

Answer:

x = 6 (A)

Explanation:

We plug y = x^2 - 5x + 3 into 5x + y = 39 and we have

5x + x^2 - 5x + 3 = 39

-> x^2 = 36

-> x = 6

Find the probability of getting 6 or more girls in 8 births.

Answers

Answer:

The probability of getting a girl is 12 . The probability of getting 6 girls is therefore (12)6 . Since we have 6 girls, we also need to find the probability of getting 2 boys, which is (12)2 . There are (86)=28 ways to get 6 girls out of 8 children.

Explanation:

Answer:

Explanation:

P(X > 6) = ?

P(X > 6) = P(X = 6) + P(X = 7) + P(X = 8)

P(X > 6) = 0.118 + 0.035 + 0.004

P(X > 6) = 0.157

Thus the probability of getting 6 or more girls in 8 births is 0.157

Your advisor can assist you with contacting other college staff or faculty in a professional manner.

O True
O False

Answers

The statement your advisor can assist you with contacting other college staff or faculty in a professional manner is : True.

Can your advisor can assist you?

This statement means that if you need to get in touch with someone else at your college, your advisor can help you do so in a professional way. This could involve introducing you to the appropriate staff or faculty member, providing you with their contact information, or helping you craft a professional email or message to reach out to them.

They can help you navigate the communication channels and ensure that your message is clear and appropriate for the intended audience.

Therefore the statement is true.

Learn more about advisor here:https://brainly.com/question/30302646

#SPJ1

Describe the transformation
F(×+5)

Answers

5 units to the left is the transformation

Answer: You subtract 5 from each x coordinate, and plot it on the graph. Or in other terms move each x coordinate 5 to the left.

Explanation: For example if i take one x coordinate and substitute it into f(x+5). In this explanation ill use (6,3). The transformation would change it to (1,3). Because we subtract 5 from the x coordinate.

What critique of society does Mandy's letter reinforce?

Answers

The correct answer is A. Gender inequality and racial discrimination.

What does Mandy's letter reinforce?

Mandy's letter reinforces a critique of society by drawing attention to the pervasive and harmful effects of gender inequality and racial discrimination.

By highlighting these issues, Mandy challenges the structural and systemic factors that perpetuate inequality and limit opportunities for marginalized groups.

Her letter underscores the need for greater awareness, understanding, and action to address these pressing social problems and build a more just and equitable society for all.

Read more about criticism here:

https://brainly.com/question/30165623

#SPJ1

Mandy's letter provides a critique of society by highlighting the issues of _________ and ____________.

A. Gender inequality and racial discrimination

B. Income inequality and environmental degradation

C. Political corruption and media bias

D. Education inequality and healthcare accessibility

List 3 speech topics addressing questions of fact

Answers

These are three speech topics addressing questions of fact:

Should the age of voting in presidential elections be lower than 18 years old?Should drivers keep a 0 policy of alcohol while driving?Having a high school degree to get a job should be mandatory?

What are speeches addressing questions of fact?

Speeches addressing questions of fact are a type of persuasive speech where the speaker addresses a part of a specific topic that is not so known or discussed.

Persuasive speeches are addressed to convince someone to believe or support an idea.

Check more information about persuasive speeches here https://brainly.com/question/9914128

#SPJ1

After studying until four in the morning, I was a bit sleepy
is this a
paradox
understandment
hyperbole
verbal irony

Answers

Answer:

understandment or anything

This is an understatement.

In a later post of yours, I explain what a paradox, understatement, hyperbole, and verbal irony are.
I hope it helps!

Some forestry professions work for logging companies

True or false

Answers

Answer:

true

Explanation:

Answer:

true

Explanation:

(9+33-6)divided 6-3 to the power of 2 pemdas

Answers

36 / 6 - 3^2
6 - 9
= -3

Pagiging lipas sa uso ng produkto

Answers

Answer:

your profile photo is very cute

) for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile odds ratio exp(2β 2
​ ) for families whose oldest automobiles differ in age by 2 years, with family confidence coefficient of approximately .90. Interpret your intervals. b. Use the Wald test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the alternatives, decision rule, and conclusion. What is the approximate P-value of the test? c. Use the likelihood ratio test to determine whether X 2
​ , age of oldest family automobile, can be dropped from the regression model; use α=.05. State the full and reduced models, decision rule, and conclusion. What is the approximate P-value of the test? How does the result here compare to that obtained for the Wald test in part (b)? d. Use the likelihood ratio test to determine whether the following three second-order terms, the square of annual family income, the

Answers

The intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

How to explain the hypothesis

a. The confidence intervals for the odds ratio of buying a new car for families whose incomes differ by 20 thousand dollars and for the age of the oldest family automobile are as follows:

Income: (1.25, 3.75)

Age of oldest automobile: (1.10, 1.90)

These intervals suggest that both income and the age of the oldest family automobile are significantly associated with the odds of buying a new car.

b. The Wald test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

Since the P-value is greater than 0.05, we cannot reject the null hypothesis that X2 does not have a significant effect on the odds of buying a new car. Therefore, we cannot conclude that X2 can be dropped from the regression model.

c. The likelihood ratio test for whether X2, age of oldest family automobile, can be dropped from the regression model is as follows:

Test statistic = 2.25

P-value = 0.13

This result is identical to the result obtained for the Wald test in part (b). This is because the Wald test and the likelihood ratio test are asymptotically equivalent, meaning that they will have the same distribution as the sample size gets larger.

d. The likelihood ratio test for whether the following three second-order terms, the square of annual family income, the square of the age of the oldest family automobile, and the interaction between income and age, can be dropped from the regression model is as follows:

Test statistic = 12.6

P-value = 0.002

Since the P-value is less than 0.05, we can reject the null hypothesis that these three terms do not have a significant effect on the odds of buying a new car. Therefore, we can conclude that these three terms cannot be dropped from the regression model.

Learn more about hypothesis on

https://brainly.com/question/606806

#SPJ1

3.
Chris wants to see if his basil plants grow better in full sunlight or partial sunlight. He
plants 5 basil plants on the east side of his house that only receives light in the
morning, and 5 more plants on the south side of his house that receives light all
day. After a month Chris measures the height of each plant.
a. Independent Variable =
b. Dependent Variable =
C. Control =

Answers

Answer:

Loading..

Explanation:

Chris wants to see if his basil plants grow better in full sunlight or partial sunlight. The variables are given, which are :

a. Independent Variable = the plant which is getting sunlight in the morning.

b. Dependent Variable = plants that are getting sunlight full day.

C. Control = both types of basil plant.

What are variables?

Variables are the main content of the experiment. There are three types of variables in an experiment. They are dependent variables, which can not be changed by the experimenter, and the independent variables are those which can be changed by the person.

Chris took the basil plant to see the experiment result of the plant. Which plant will be gore more with sunlight or less sunlight?

Thus, the different variables are:

a. Independent Variables are the plant which is getting sunlight in the morning.

b. Dependent Variable = plants that are getting sunlight full day.

C. Control = both types of basil plant.

To learn more about variables, refer to the below link:

https://brainly.com/question/17344045

#SPJ2

If a solid were placed on the moon, would its density change?

O No, density is a measure of a mass to volume ratio. Mass does not change between planetary
objects.

O Yes, density is a measure of a mass to volume ratio. Mass does change between planetary objects.

O No, density is a measure of weight to volume ratio. Mass does not change between planetary
objects.

O Yes density is a measure of a weight to volume ratio, Weight does not change between planetary
objects.

Answers

Answer:

no

Explanation:

Moving from the gravity of the Earth to the gravity of the moon, the astronaut’s weight certainly changes, but his mass remains the same. There is less air pressure in space, but astronauts don’t blow up like bubbles once they leave Earth’s atmosphere, so you can safely assume that the astronaut’s volume doesn’t really change either. If the mass and the volume don’t change on the moon, you can deduce that the astronaut’s density would be the same.

If a solid were placed on the moon, its density does not change, density is a measure of a mass-to-volume ratio, hence option A is correct.

Why mass does not change between planetary objects?

The astronaut's weight changes when he travels from Earth's gravity to the moon's gravity, but his mass does not. The volume of an astronaut doesn't really change even if there is less air pressure in space since astronauts don't blow up like bubbles once they leave Earth's atmosphere.

Density is defined as the measure of the compound from the ratio of mass and volume. It is related to the composition of the planet.

You can infer that the astronaut's density would remain constant if the mass and volume didn't change on the moon.

Therefore, density is a measure of a mass-to-volume ratio. Mass does not change between planetary objects.

Learn more about the planet, here:

https://brainly.com/question/30067719

#SPJ2

What is a goal of the mission of the James Webb Space Telescope?

to find evidence of life on Mars

to study how solar flares of our sun affect Earth

to find evidence of events in the history of the universe

to study how Venus and Earth diverged as planets

(33 points)

Answers

Answer:

to find evidence of events in the history of the universe

Explanation:

A goal of the mission of the James Webb Space Telescope is to find evidence of events in the history of the universe.

The correct answer to the given question is option C.

The James Webb Space Telescope has several objectives and goals, with the primary aim of its mission being to identify the events that led to the formation of the universe.

In addition, it aims to collect data on various galaxies, stars, and planets that will help scientists determine the evolution of these entities.The primary objective of the James Webb Space Telescope is to identify the early universe's formation by collecting data on the stars, galaxies, and planets.

It is also aimed at gathering data on various celestial objects such as exoplanets and black holes.The James Webb Space Telescope aims to collect data that will allow astronomers to determine the events that led to the formation of the universe.

It will collect data on distant galaxies, stars, and planets to provide insights into the evolution of these entities. The telescope will have advanced capabilities such as infrared vision that will allow it to collect data on some of the universe's earliest structures.

Additionally, the James Webb Space Telescope aims to collect data on exoplanets, which could provide insights into how life in the universe developed. The telescope's ability to identify the atmospheric composition of exoplanets will be crucial in determining their habitability.

Ultimately, the telescope's primary goal is to contribute to the advancement of our understanding of the universe.

For more such questions on James Webb Space Telescope, click on:

https://brainly.com/question/8962979

#SPJ8

“Who am I?”
- -
\ /
;-;
|
|
/ \
/ \
- -

Answers

you are nevahbowe. Hope you are askibg me your name

what is the inverse of f(x)=3x-5/2?

Answers

f^-1(x)= 1/3x + 5/6 ..

Answer:

f−1(x)=x/3+5/6

Explanation:

Are we expecting too much from public opinion polls? Why or why not

Answers

Answer: yes

Explanation: yes because Election indicates who wins. Public polling, done right, remains the best way of obtaining citizens opinions, and we think that if we elect a specific president we will get a better result of life. Example: Joe Biden and Donald Trump


In order to reduce production costs, autoworks an automobile manufacturer, decided to buy out a glass plant and begin manufacturing the glass for the windows of cars on its own. The corporate strategy adopted by the company is known as.

Answers

Answer:

the glass for the windows of cars on its own.

Explanation:

lol

The glass for the windows of cars on its own.

What is Corporate Stratergy?

Corporate strategy is the strategy level that concerns itself with the entirety of the organization, where decisions are made with regard to the overall growth and direction of a company.

Corporate strategies are arguably the most essential and broad-ranging strategy level within an organizational strategy.

Corporate level strategy refers to the highest level of corporate strategic planning. In this article, we dive deeper into it, but it’s useful to understand the other strategic levels as well and how they are related.

Therefore, The glass for the windows of cars on its own.

To learn more about Corporate stratergy, refer to the link:

https://brainly.com/question/28795165

#SPJ2

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

The University of Florida Honors Program is a "community of scholars" bound together

by a shared interest in maximizing the undergraduate experience. Why are you drawn to

this type of community at UF, and how do you plan to contribute to it in and out of the

classroom?

Answers

I am drawn to the University of Florida Honors Program because I am looking for a community of scholars who are passionate about learning and who are committed to making a difference in the world. I believe that the Honors Program will provide me with the opportunity to learn from and collaborate with some of the brightest minds at UF, and I am excited to be a part of this community.

I plan to contribute to the Honors Program in and out of the classroom by being a active participant in class discussions, by volunteering my time to help with Honors events, and by mentoring younger students. I am also interested in starting an Honors student organization that will focus on social justice issues.

I believe that the Honors Program will provide me with the tools and resources I need to succeed in my academic career and to make a difference in the world. I am excited to be a part of this community and to contribute to its success.

Here are some specific ways I plan to contribute to the Honors Program:

In the classroom, I will be an active participant in class discussions and will share my ideas and insights with my classmates. I will also be a helpful and supportive classmate, and I will be willing to help others learn.
Outside of the classroom, I will volunteer my time to help with Honors events. I will also be a mentor to younger students, and I will share my experiences with them and help them to succeed.
I am also interested in starting an Honors student organization that will focus on social justice issues. I believe that this organization can make a positive impact on the UF campus and on the world.
I am confident that I would be a valuable asset to the University of Florida Honors Program. I am a hard worker, I am passionate about learning, and I am committed to making a difference in the world. I am excited to be a part of this community and to contribute to its success.

LEARNING TASK 6 Directions: Using the diagram below, write down the types of geometric figures and its classifications. Draw it in your sketch pad. Geometric Figures 1. a. b. C. d. 2. a. b. C. d. 3. a. b. C. d. 4. a. b. C. d. 5. a. b. C. d.



Please answer correctly my deadline is tomorrow ​

LEARNING TASK 6 Directions: Using the diagram below, write down the types of geometric figures and its

Answers

The types of geometric figures are:

   Two-dimensional figures:    Three-dimensional figures   Quadrilaterals Polygons    Curved figures

What ae the classifications  of geometric figures?

Two-dimensional figures:

a. Point: A point is a location in space that has no dimensions.

b. Line: A line is a straight path that extends infinitely in both directions.

c. Circle: A circle is a closed shape made up of all the points that are equidistant from a fixed point called the center.

d. Triangle: A triangle is a three-sided polygon.

Three-dimensional figures:

a. Cube: A cube is a three-dimensional shape with six square faces that are all congruent.

b. Sphere: A sphere is a three-dimensional shape that is perfectly round and has no edges or vertices.

c. Cylinder: A cylinder is a three-dimensional shape with two circular bases that are parallel and congruent and connected by a curved surface.

d. Cone: A cone is a three-dimensional shape with a circular base that tapers to a point at the top.

Quadrilaterals:

a. Square: A square is a quadrilateral with four congruent sides and four right angles.

b. Rectangle: A rectangle is a quadrilateral with four right angles and opposite sides that are parallel and congruent.

c. Rhombus: A rhombus is a quadrilateral with all sides equal in length, and opposite angles are congruent.

d. Parallelogram: A parallelogram is a quadrilateral with opposite sides parallel and congruent.

Polygons:

a. Pentagon: A pentagon is a five-sided polygon.

b. Hexagon: A hexagon is a six-sided polygon.

c. Octagon: An octagon is an eight-sided polygon.

d. Decagon: A decagon is a ten-sided polygon.

Lastly, Curved figures:

a. Ellipse: An ellipse is a flattened circle with two axes of symmetry.

b. Parabola: A parabola is a U-shaped curve that is symmetrical.

c. Hyperbola: A hyperbola is a symmetrical curve with two branches that open up and down or left and right.

d. Sine wave: A sine wave is a curve that describes a smooth repetitive oscillation.

Read more about geometric figures here:

https://brainly.com/question/26940398

#SPJ1

In the figure above, a line passes through the point A (2,3) and never crosses the y axis. The line also passes through which of the following points?
a) (-2,3).
b) (-2,2).
c) (2,4).
d) (3,3)

Answers

Answer is c. (2,4)
Reason
(without seeing the graph)
With the same x value and a different y value the line will be straight up and down (vertical line) never crossing the y axis

What are the next numbers in this pattern: 2 5 7 ... 19 ...

Answers

2,5,7,9,11,13,15,17,18,19,21,23,25,27,29,31,33,35,37,39,41

Answer: Below:

Explanation:

2 + 3 = 5

5 + 2 = 7

You add the previous number to the current one to get the next number

so the whole set is:

2, 5, 7, 12, 19, 31, 50, 81, 131, 211, 342...

HELP PLEASE!!
Billi opens a certificate of deposit to see how much money he can earn in a
year. After one year, he notices that the account has more money in it than he
calculated. What is most likely the cause of this error?
A. Billi calculated the interest assuming it was simple when it was
actually compounded.
B. Billi calculated the interest assuming it was compound when it
was actually simple.
C. Billi did not account for inflation affecting the value of his money.
D. Billi accounted for inflation but added up the interest wrong.
SUBMIT

Answers

Answer:

b

Explanation:

Answer:

Its actually A

Explanation:

Find the consumer price index or cost living by aggregate method or family budget method

Answers

The Consumer Price Indexx (CPI) is typically calculated using the aggregate method, which measures the average change in prices for a fixed basket of goods and services over time.

What is a Family Budget Method?

The Family Budget Method, on the other hand, is a method used to estimate the minimum income necessary for a family to meet its basic needs. It involves identifying the typical expenses of a family, such as food, housing, transportation, healthcare, and other necessities, and estimating the cost of those expenses in a given geographic area.

While both methods are used to measure changes in the cost of living, the CPI is a broader measure that reflects changes in prices for all consumers, while the Family Budget Method is more focused on the specific expenses of a particular type of household.

To know more about Consumer Price Index, Check out:

https://brainly.com/question/19245789

#SPJ1

Is it risky to go to NASA at the age of 16? ​

Answers

Answer: Follow your dreams

Explanation:  (Google Search )

There are no age restrictions for the NASA Astronaut Corps. Astronaut candidates have ranged between the ages of 26 and 46, with the average age being 34. Candidates must be U.S. citizens to apply for the program. There are three broad categories of qualifications: education, work experience, and medical

Answer:

Yes

Explanation:

You could be more exposed to the risks of radiation and sickness


Robert, John, Enrique, Mark, and Thomas participate in a 2-mile run during gym class. The total average of all 5 runners is
15.3 minutes, and the average of Robert, John, and Enrique is 14.4 minutes. What is the average time for Mark and Thomas?

Answers

Answer:

Explanation:

Robert + John + Enrique + Mark + Thomas = 15.3 ------(1)

Robert + John + Enrique = 14.4 -------(2)

Putting value in Equation 1:

14.4 + Mark + Thomas  = 15.3

Hence:

Mark + Thomas = 0.9

Claim
Sebastian acts as a faithful servant to Ariel
throughout the movie.
Evidence
Sebastian shows his loyalty by
sticking with Ariel when she is living
on land, even though she has
disobeyed his commands.

ClaimSebastian acts as a faithful servant to Arielthroughout the movie.EvidenceSebastian shows his loyalty

Answers

Answer:

the little mermaid

Explanation:

I watched it before

Ohio Traffic Stats show that about _____ of fatal crashes resulted from failing to wear a safety belt

Answers

Ohio Traffic Stats, about 40% of fatal crashes resulted from failing to wear a safety belt.

This means that a significant portion of fatalities on the road could have been prevented if the individuals involved had been wearing their seat belts. It is important to remember to always wear a safety belt when driving or riding in a car, as it can greatly reduce the risk of injury or death in the event of a crash. Traffic fatalities refer to the number of people who are killed in motor vehicle accidents or crashes. This statistic is often used as a measure of road safety and is tracked by government agencies and organizations around the world. The number of traffic fatalities can be affected by a variety of factors, including driver behavior, road conditions, vehicle design, and emergency response times.

To learn more about Traffic :

https://brainly.com/question/22768531

#SPJ4

A plant grew 17 inches in one year.

1 inch is approximately equivalent to 2.5 centimetres .
Approximately how much did the plant grow in centimetres ?

Answers

Answer:

42.5 centimeteres

Other Questions
help me please!!!! btw your amazing For the graph, find the average rate of change on the intervals givenSee attached picture What was the impact of the Enabling Act? A. Let Hitler make decisions with the German government B. Gave hitler total control of Germany C. Enabled hitler to run for president D. Enabled hitler to become president what items account for the largest percentage of the nanual federal budge? why are entitlements and interest on the nationa debt consdiered modatroy spending the nurse is teaching a client with gastroesophageal reflux disease (gerd) about how to reduce reflux. what should the nurse include in the teaching? select all that apply. The distance in feet required to stop a certain vehicle is given by: 2 d(t) = v + 36 If you don't want your stopping distance to exceed 180 feet, at what range of speed can you travel? Question 2 Find the quotient and remainder of - gp2 +* - 4 2+1 using: (a) Long division (b) Synthetic division In which type of macromolecule do mutations occur in humans? What kind of graph is this ?A. Positive B. Negative C. Zero D. Undefined Serena is cycling from dance class to her home. The equation shows Serena's distance (y), in miles, from her home after x minutes:y = 16 6xWhat does the number 16 in the equation represent? Serena's distance from home when she begins cycling Serena's distance from the dance class when she begins cycling The speed at which Serena is cycling from the dance class to her home The rate of change of Serena's speed while cycling from the dance class to her home Read the passage from Hamlet, Act I, Scene iii. Laertes: Be wary then; best safety lies in fear: Youth to itself rebels, though none else near. Which word from the passage is most similar in meaning to wary? safety fear youth rebels What inference can be drawn about the bank clerk's emotional state in this excerpt? Which of these are true when solving a one dimensional motion when quetion is an algebraic physics. find the z-score such that the interval within standard deviations of the mean for a normal distribution contains 87% of the probability. Prove that the function given by f(x)=cosx is neither increasing nor decreasing in (0,2). What types of organisms typically make up the base,middle,and top of a food web?explain your reasoning Which two words are the closest antonyms?A. universal and exclusiveB. expansion and affirmationC. oppression and legislationD. ardent and prosperous How did Mansa Musa help change West Africa and how people in Europe viewed this place?I need 3-5 sentences and cant come up with that much. Q 12. 42: Hyperion Industries uses the indirect method of reporting operating activities. Where would theydisclose impairment on goodwill?On a separate schedule attached to the statement of cash flowsBOn other documents unrelated to the statement of cash flowsOn an adjusted trial balanceDOn the face of the statement of cash flows MARKING BRAINLEST!! i need the answers to Q11 and 14 What is the smallest possible average of four distinct positive even integers?