Which of the following is the most geologically active region on the surface of Earth?
A glacial valleys B recharge zones
C mountain peaks D boundaries between tectonic plates
The most geologically active region on the surface of Earth is the boundaries between tectonic plates. The correct option is D.
What are tectonic plates?Huge fragments of the Earth's crust and upper mantle make up tectonic plates. They are composed of both continental and oceanic crust. Around mid-ocean ridges and the significant faults that define the plate boundaries, earthquakes happen.
Three different types of tectonic boundaries are produced by the movement of the plates: transform, where the plates move sideways with respect to one another, and convergent, where the plates move into one another. One to two inches (three to five cm) of movement occurs per year.
Therefore, the correct option is D. boundaries between tectonic plates.
To learn more about tectonic plates, refer to the link:
https://brainly.com/question/19317822
#SPJ6
The percentage decrease in mass is used to compare the results explain why
The percentage decrease is used because the difference in mass does not deal with the proportional aspect of the solutions whereas the percent is calculated to give an exact difference, including the quantities of solution.
What is the percentage decrease in mass?Percentage decrease in mass simply means the percentage by which the mass of a substance was decreased in chemistry.
Now, the difference in mass is sometimes useful but then it does not deal with the proportional aspect of the solutions, which makes the results less accurate.
The percentage decrease in mass is usually calculated to give an exact difference while inspecting the quantities of solution.
Read more about percentage decrease in mass at; https://brainly.com/question/23885199
#SPJ1
Does anyone have SAT practice tips? So far I'm using Khan Academy as my main resource to use their practice tests and suggested practice based on my PSAT from 9th grade.
Answer:
Read section directions before the test. ...
Answer the questions you know first. ...
Eliminate incorrect answers. ...
Be neat. ...
Use your test booklet. ...
Avoid stray marks. ...
Your first response is usually correct. ...
There is only one correct answer.
Hope this helps and Hopefully you pass!!!! :)
Is it risky to go to NASA at the age of 16?
Answer: Follow your dreams
Explanation: (Google Search )
There are no age restrictions for the NASA Astronaut Corps. Astronaut candidates have ranged between the ages of 26 and 46, with the average age being 34. Candidates must be U.S. citizens to apply for the program. There are three broad categories of qualifications: education, work experience, and medical
Answer:
Yes
Explanation:
You could be more exposed to the risks of radiation and sickness
Predict the amount of profit, in dollars, the district office will make if 1,200 people attend the School Fair.
Based on the table, the school fair makes $100 per person in attendance. If 1,200 people attend, the school fair will make $120,000.
The school district office uses 70% of this money for maintenance costs and other expenses, leaving 30% for profit.
Therefore, the school district office will make a profit of $36,000 if 1,200 people attend the school fair.
How to calculate the amountTotal money made from the school fair: $120,000
Amount used for maintenance costs and other expenses: 70% * $120,000 = $84,000
Here is the formula for calculating the profit from a school fair:
Profit = Total amount of money made from the fair - Amount used for maintenance costs and other expenses
In this case, the profit is calculated as follows:
Profit = $120,000 - $84,000 = $36,000
Profit: $120,000 - $84,000 = $36,000
Learn more about profit on
https://brainly.com/question/1078746
#SPJ1
Which best describes what financial planning skills ultimately enable an individual to do? to prepare for the future to determine lifetime income to determine the cost of living to learn from the past.
Answer:
A. Prepare for the future
Explanation:
Alcohol makes it impossible to?
A. be yourself
B. look uncool
C. feel pain
D. be bored
Answer:
a
Explanation:
Answer:
when you are on drugs its hard to be yourself since your all high and stuff.
put the levels of organization of an ecosystem in order from smallest (1) to largest (4)
Answer:
Organism, population, community, ecosystem, biosphere
Explanation:
I need brainliest
Based on what you know about matter, explain why the food coloring mixes at different rates
Give me a song recommendation
*It doesn't matter what genre*
I like all kinds of music :)
Answer:
Kill Bill.
Explanation:
I want to know how to solve it.
Answer:
f(1+g(1))=2 is your answer
Explanation:
we have
f(x)={2x-2}/(x²+1)
g(x)=x²+1
now
f(1+g(1))=f(1+(1²+1))=f(1+2)=f(3)={2×3-2}/(1²+1)=4/2=2
What is the volume of a cube that is 20cm long when you flatten it out
The volume of a cube is equal to the length of all its sides cubed, which in this case is 20cm x 20cm x 20cm = 8000 cm^3. Therefore, the volume of a cube that is 20cm long when flattened out is 8000 cm^3.
What is volume?Volume is the three-dimensional space occupied by an object or substance. It is typically measured in units such as cubic meters (m3), cubic centimeters (cm3), liters (L), or milliliters (mL). Volume is an important physical property of an object or substance, which can be used to determine the total amount of material present in an object or substance. Volume is also used to measure the capacity of a container, such as a tank, bottle, or bucket, and can also be used to measure the amount of liquid, gas, or solid contained within. Volume is an important concept in mathematics, and is used in the calculation of areas, perimeters, and volumes of geometric shapes. It can also be used to measure the rate at which a substance is flowing, such as in the calculation of fluid flow rates.
To learn more about volume
https://brainly.com/question/26426890
#SPJ4
How does the size of animal affect the amount of food it can eat
Answer:
Explanation:
it has a big mass, so it needs a lot of food to sustain it’s large mass.
also it has a bigger stomach.
A fish tank in a pet store was less than half full of
water when a worker turned on a hose to fill the
tank at a constant rate. After the hose was on for
5 minutes, the tank was exactly half full. After
the hose was on for 30 minutes, the tank was
three-quarters full. How many minutes did it take
after the hose was turned on for the tank to be
completely filled with water?
What is the likely source of pollution if there are frequent algal blooms in a river?
Group of answer choices
warm water discharge from nearby factories
fertilizer runoff from nearby farms
acidification of the water from acid rain
oil discharge from a nearby oil rig
Answer:
Fertilizer runoff from nearby farms
Explanation:
Fertilizer contains an excess of nutrients, including phosphorus. When fertilizer runs into nearby waterbodies (such as rivers), algae uses these nutrients as a food source, and an algal bloom will occur due to that large sum of available nutrients.
Write the equation of a parabola that has vertex (2.5, 2.75) and passes throught the point (1,5).
Answer:
y = (x - 2.5)^2 + 2.75
Explanation:
y = a(x - h)^2 + k - Vertex form
y = a(x - 2.5)^2 + 2.75 - Replacing h with 2.5 and k with 2.75
5 = a(1 - 2.5)^2 + 2.75 - Replacing x with 1 and y with 5
5 = 2.25a + 2.75 - Doing (1 - 2.5)^2 = 2.25 times a = 2.25a
2.25 = 2.25a - Subtracting 2.75 on both sides
a = 1
y = 1(x - 2.5)^2 + 2.75 - Replacing a with 1
So the equation of a parabola is y = (x - 2.5)^2 + 2.75
The vertex of a parabola is the minimum or the maximum point of the parabola
The equation of the parabola is \(\mathbf{y = a(x -1)^2 + 5}\)
The given parameters are:
\(\mathbf{(x,y) = (2.5,2.75)}\) --- point
\(\mathbf{(h,k) = (1,5)}\) -- vertex
A parabola is represented as:
\(\mathbf{y = a(x -h)^2 + k}\)
Substitute the given values in the above formula
\(\mathbf{2.75 = a(2.5 -1)^2 + 5}\)
\(\mathbf{2.75 = a(1.5)^2 + 5}\)
\(\mathbf{2.75 = 2.25a + 5}\)
Subtract 5 from both sides
\(\mathbf{2.25a =-2.25}\)
Divide both sides by 2.25
\(\mathbf{a =-1}\)
Substitute \(\mathbf{a =-1}\) and \(\mathbf{(h,k) = (1,5)}\) in \(\mathbf{y = a(x -h)^2 + k}\)
\(\mathbf{y = a(x -1)^2 + 5}\)
Hence, the equation of the parabola is \(\mathbf{y = a(x -1)^2 + 5}\)
Read more about parabolas at:
https://brainly.com/question/21685473
How does the information in the NASA article best add to a reader’s understanding of Team Moon?
If you answer this question and brainliest I will do it back....
-Lilly Ketchmen <3
Answer: It gives the reader a better sense of the complex problem solving taking place at mission control. it gives the reader a more detailed sense of the intense emotions being felt at mission control.
Explanation: Hope this helps
Your family is experiencing financial crisis what are the factors that led you to this decision.
Answer:
a) drinking alcohol b) unnecessary expenses c) peer pressure d) carelessness
Explanation:
Go on kahoot and type in 272 9043 and play and will mark brainliest type in your brainly name so i know :)
Answer:
ok???
Explanation:
Answer:
yeehaaw
Explanation:
chicken wing chicken wing hot dog and bologna chicken and macaroni chillin with my homies
Answer:
I love that songgggg
Answer:
Ayyyy
Explanation:
_____, one of the greatest writers in history, emerged during the Renaissance.
William Shakespeare
William Wadsworth
William Smith yes we all know the answer is A thanks tho Imfao
Answer:
Williaam shakespeare
Explanation:
Explain how the number of text messages dario sent
Answer:
the text of the former by the number of the dario is sent
Essay Bread by Margaret Atwood 1 Imagine a piece of bread. You don't have to imagine it, it's right here in the kitchen, on the breadboard, in its plastic bag, lying beside the bread knife. The bread knife is an old one you picked up at an auction; it has the word BREAD carved into the wooden handle. You open the bag, pull back the wrapper, cut yourself a slice. You put butter on it, then peanut butter, then honey, and you fold it over. Some of the honey runs out onto your fingers and you lick it off. It takes you about a minute to eat the bread. This bread happens to be brown, but there is also white bread, in the refrigerator, and a heel of rye you got last week, round as a full stomach then, now going moldy. Occasionally you make bread. You think of it as something relaxing to do with your hands. 2 Imagine a famine. Now imagine a piece of bread. Both of these things are real but you happen to be in the same room with only one of them. Put yourself into a different room, that's what the mind is for. You are now lying on a thin mattress in a hot room. The walls are made of dried earth, and your sister, who is younger than you, is in the room with you. She is starving, her belly is bloated, flies land on her eyes; you brush them off with your hand. You have a cloth too, filthy but damp, and you press it to her lips and forehead. The piece of bread is the bread you've been saving, for days it seems. You are as hungry as she is, but not yet as weak. How long does this take? When will someone come with more bread? You think of going out to see if you might find something that could be eaten, but outside the streets are infested with scavengers and the stink of corpses is everywhere. Should you share the bread or give the whole piece to your sister? Should you eat the piece of bread yourself? After all, you have a better chance of living, you're stronger. How long does it take to decide?
Answer:
In Bread by Margaret Atwood we have the theme of perception, connection, control, greed and change. Narrated in the first person by an unnamed narrator the reader realises after reading the story that Atwood may be exploring the theme of perception and change. It is as though by her continued use of the word ‘imagine’ in each paragraph that Atwood is attempting to change the readers opinion on something as simple as a piece of bread (or food in general). Each paragraph in the story takes on a different situation. Each involving bread and how an individual can be effected by either having no bread or having a plentiful supply of bread. The first paragraph of the story as an example there are three different types of bread available to the reader. Which may leave some critics to suggest that Atwood is targeting the middle classes of the Western world. A world in whereby one has more than they need. Though may not necessarily be able to connect with those who have little or nothing. A fact that is reiterated in the second paragraph of the story when Atwood brings in a young boy who is starving and who is unsure as to whether to eat the only piece of bread available to him or to give it to his sister who is also starving.
The third paragraph which is set in a prison has a strong theme revolving around control. As a prisoner the reader is forced to imagine that they must admit to what their captors want them to admit to in order to survive. As to whether the prisoner is going to tell the truth is not so much the point. The point is that others by using food as a bargaining chip have complete control over the prisoner. The prisoner also is more captive to their home, symbolized by the yellow bowl, than they are to the pieces of bread that may be offered to them. Which may be the point that Atwood is attempting to make. Home for the prisoner represents comfort. A place in whereby they are not confronted with the choices that are imposed on them in prison. A simple thing like bread is not as important to the prisoner as they have the luxury of eating bread in their own home on their own timetable. Something that is not afforded to the prisoner while in prison. In prison the bread being offered is being used as a bargaining chip.
The fourth paragraph of the story is also interesting as Atwood appears to be drawing on the German folk tale ‘God’s Food’ to highlight how those who have plenty can be selfish and greedy regardless of who may ask them for help. Again there is a sense that Atwood is directing the reader’s attention to the middle classes and possibly suggesting that they have lost connection with those who are less fortunate. The woman in the folk tale has no sympathy for her sister. This could be important as it suggests that the woman may have forgotten her roots and may in reality be dazzled or blinded by her own success. Leaving her sister to starve. Something that some readers may consider to be shocking but nonetheless a part of life. A person may progress in life and forget about where they come from and forgo assisting those who know them best. As is the case in the folk tale. The blood that comes from the bread when the husband cuts the bread may also symbolise the sister’s blood. She is sure to die as she has no food to eat.
The themes of perception, connection, control, greed, and transformation are explored in Bread by Margaret Atwood. After reading the story, the reader realizes that Atwood may be examining the issue of perception and transformation.
What is the theme of the poem "Margaret Atwood"?The story is told in the first person by an unidentified narrator. It appears that Atwood is trying to sway the reader's view about something as basic as a loaf of bread by repeatedly using the word "imagine" in each line (or food in general). The story's paragraphs each focus on a distinct situation. Every one of them concerning bread and how having either no bread or a lot of bread could affect a person.
Three different sorts of bread are available to the reader in the first paragraph of the text as an illustration. This could lead some detractors to claim that Atwood is speaking directly to the Western middle class. a setting where people have more than they require. However, you might not always be able to relate to people who have little to nothing. This aspect is emphasized in the second paragraph of the story by Atwood, who introduces a young boy who is famished and torn between eating the single piece of bread he can find and giving it to his starving sister.
Control is a major issue in the third paragraph, which is set in a prison. The reader is made to envision themselves in the position of a captive who must confess to what their captors want them to confess to survive. The question of whether the prisoner will disclose the truth is not the main concern. The idea is that others may completely control the prisoner by using food as a bargaining chip. The yellow bowl represents the prisoner's house, which they are more hostage to than they are to any bread that may be handed to them. Which may be the argument Atwood is putting up. For the prisoner, a home is a place of comfort.
The fourth line of the story is also intriguing because Atwood seems to be using the German folktale "God's Food" to show how those with plenty may be ungrateful and selfish no matter who asks for assistance. Once more, it seems as though Atwood is calling the reader's attention to the middle classes and posing the possibility that they have forgotten about others who are less fortunate. In the folktale, the woman shows no pity for her sister. This could be significant since it implies that the woman may have lost sight of her origins and may perhaps be oblivious to or dazzled by her success. allowing her sibling to go hungry. Something that may be disturbing to some readers but is nevertheless a fact of life. As one moves through life, one could lose sight of their origins and neglect to help the people closest to them. similar to how it is in the folktale. When the husband chops the bread, blood may spill out, symbolizing the sister's blood. She has nothing to eat, thus death is a given.
To learn more about Margaret Atwood refer to:
https://brainly.com/question/27906580
#SPJ2
Explain two ways in which beliefs about creation influence christians today
Sam is preparing lunch for 100 people. Today’s menu is Oven Fried Chicken, Steamed Corn, and Mashed Potatoes. Lunch service begins at 12:00pm. Consider the following:
-The chicken will take 30 minutes to bread and pan up. You then need to bake it for 30 minutes. -The corn is frozen and needs to be taken out of its packaging and placed in a perforated pan for steaming. Then it needs to steam for about 10 minutes.
-The potatoes must be peeled, cubed, and then boiled, taking about 1 hour. Then they must be drained, mashed, and seasoned, taking about 15 minutes.
Explain your timeline to complete these tasks. When would you start making lunch? What tasks would you complete and when?
The lane markings in this image indicate that _____
A. Both cars are approaching a passing zone
B. Both cars are leaving a no passing zone.
C. It is legal to pass in either direction
D.both cars are currently in a passing zone
Answer:
D
Explanation:
Both cars have a yellow dashed line, which means that cars can currently use the other lane.
read this sentence from the article.i think it is vital to consider the scientific definition of life, however, and to take the recent excitement with a grain of salt.explain the meaning of the phrase “with a grain of salt” as it is used in the sentence. use details from the article to support your answer.
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
Which of the following is the cheapest route to visit each city using the nearest neighbor route starting from a and ending at a.
yall tmr my birthday and my SAT i rlly need help on this question
Answer:
B
Explanation:
I added the 1 to 4 and the 5 or more to get the numerator and then plugged in 100 as the denominator to get the probability.
p.s. have the loveliest birthday ever and good luck on your SAT's