answer:
hi!
here are 3 study tips that will make your work easier & more productive!
1. write a list of what you would like to do today! it can even be unrelated to school work! such as maybe watching a fav show, simply drinking more water, or making a baking recipe you wanted to try, or cleaning your room!
2. turn your phone off or go charge it! it'll make focusing alot eaiser!
3. go to your list of assginments due, and look at what you have missing/not done, write them down in every subject and go through them one by one!
example:
bio
assginment 4.02, 4.03 and 40.4
english
assigment 6.09, 7.00, 7.01 and 7.02
and so on and so forth.
explanation:
hope this helped <3 also if wouldn't mind could you pls give me brainliest? (im trying to level up) thanks! :)
stop giving wrong answersdumba**es
Answer:
ok, what is your answer?
Record at least two new questions you have about light.
1. How does light interact with different materials and what factors affect this interaction?
2. How does the wavelength of light affect its properties and behavior, and how is this related to the electromagnetic spectrum?
Consider the following figure ABDC with diagonal BC. Sides AB and DC are congruent angle A is congruent to angle D and sides AC and DB are congruent
Quadrilateral ABCD is both a parallelogram and a rhombus.
The figure ABDC with diagonal BC, with the congruent sides AB and DC, angle A is congruent to angle D, and sides AC and DB are congruent is a parallelogram. This is based on the definition of a parallelogram which is a quadrilateral with opposite sides that are parallel and congruent to each other.
Also, opposite angles of a parallelogram are congruent. Therefore, angle A and angle C are congruent. Additionally, angle B and angle D are also congruent because they are opposite angles of a parallelogram.The diagonal of a parallelogram cuts it into two congruent triangles.
Triangle ABD and triangle CBD are congruent triangles, since their sides are congruent, and angles A and D, and angles B and C, are congruent by the given information.
Therefore, their included angles ABD and CBD are also congruent. Because their opposite sides are congruent, quadrilateral ABCD is a rhombus. A rhombus is a parallelogram with all sides congruent. This implies that sides AB, BC, CD, and DA are all equal.
In conclusion, quadrilateral ABCD is both a parallelogram and a rhombus.
For more such questions on parallelogram, click on:
https://brainly.com/question/3050890
#SPJ8
The average age of a breed of dog is 19. 5 years. If the distribution of their ages is normal and 20% of dogs are older than 22. 6 years, find the standard deviation
The standard deviation of the ages of this breed of dog is approximately 4.4 years.
To find the standard deviation, we can use the concept of z-scores and the cumulative distribution function (CDF) of a standard normal distribution. Let's denote the average age as μ (mu) and the standard deviation as σ (sigma).
Given that the average age of the breed is 19.5 years, we can set μ = 19.5. We are also given that 20% of the dogs are older than 22.6 years. Using the z-score formula, we can calculate the z-score corresponding to this percentile:
z = (x - μ) / σ
Where x is the given value (22.6 years) and z is the z-score. Rearranging the formula, we can solve for σ:
σ = (x - μ) / z
Plugging in the values, we have:
σ = (22.6 - 19.5) / z
To find the z-score corresponding to the 20th percentile, we can use the inverse CDF of the standard normal distribution. Using statistical software or a z-table, we find that the z-score corresponding to the 20th percentile is approximately -0.84.
Substituting the values, we get:
σ = (22.6 - 19.5) / -0.84 ≈ 3.7 / -0.84 ≈ -4.4
For more such questions on deviation,click on
https://brainly.com/question/30100922
#SPJ8
The average age of a breed of dog \(= μ = 19.5\) yearsThe percentage of dogs that are older than 22.6 years = 20%Let's calculate the z-score of the given percentage\(:z = (x - μ) / σ20 = (22.6 - 19.5) / σσ = (22.6 - 19.5) / 0.84σ = 3.69 / 0.84σ = 4.39\) (approximately)
Therefore, the standard deviation is approximately 4.39 years.Explanation:Given, the average age of a breed of dog\(= μ = 19.5\)yearsThe percentage of dogs that are older than 22.6 years = 20%Let's calculate the z-score of the given percentage:z = (x - μ) / σ
Where\(,x = 22.6μ = 19.5σ =\)Standard deviationThen,\(20 = (22.6 - 19.5) / σσ = (22.6 - 19.5) / 0.84σ = 3.69 / 0.84σ = 4.39\)(approximately)Therefore, the standard deviation is approximately 4.39 years.
To know more about approximately visit:
https://brainly.com/question/16315366
#SPJ11
This planet closely resembles our moon.
Venus
Mars
Mercury
Earth
Answer:
Venus
Explanation:
Venus now closely resembles a dazzling silvery-white "half-moon." In the nights that follow it gradually becomes a fat crescent while growing ever larger as it swings around in its orbit closer to Earth
Why is gum pink? I've always been wondering about this.
Answer: Bubble gum got its distinctive pink color because the original recipe Diemer worked on produced a dingy gray colored gum, so he added red dye (diluted to pink) as that was the only dye he had on hand at the time.
Who was Alexander Graham Bell?
List three things you will need on the PSAT/NMSQT test day according to the "Taking the Tests" web page
Answer: Two No.2 pencils with erasers.
An approved calculator.
Your valid school ID or government-issued ID
Explanation: For students who may have need: Epi-pen or other prescribed medication in a clear plastic bag.
5. A fair coin is flipped 4
times in a row. What is the
probability that the resulting
sequence of flips is not 4
heads in a row?
Answer:
The answer is 1/16 sinces theres only one oppurtunity of it happening
Explanation:
Is it possible to make a cheer dance routine with you family in this time of pandemic how brainly.
Answer:
umm yeah, you are with your family
Explanation:
Some common ways that criminals try to pressure people into falling for a scam include creating a sense of urgency,appealing to your emotions and__ (everfi)
1) making an offer that needs to be compared with other products to see if it is a good deal
2)by threatening physical violence
3)meeting in person to build trust
4)making an offer that seems too good to be true
5. On a test consisting of 60 questions, Susan
answered 90 percent of the first 50 questions
correctly. What percent of the other 10
questions does she need to answer correctly for
her grade on the entire exam to be exactly
80 percent?
(A) 30 percent
(B) 40 percent
(C) 50 percent
(D) 60 percent
Helia began charging her cell phone battery when it was
30% charged. After 36 minutes, her cell phone battery
was 70% charged. If the cell phone battery charges at a
constant rate, how many more minutes will it take for
her cell phone battery to be exactly 80% charged?
Answer:
After 9 more minutes, her cell battery will be 80% charged.
Explanation:
Let us try to make an equation here to describe the relation between battery and time.
It is given that the battery charges at a constant rate so we can assume that
battery(\(b\)) ∝ Time(\(t\))
\(\Rightarrow b=kt\)
But at t=0, the battery is already 30% charged so we rewrite the equation as follows:
\(b=kt+30\) -(1)
Now,
at put t=36 and b=70 in Eqn 1:
We get \(k=\frac{10}{9}\)
The final eqn is \(b=\frac{10}{9}t +30\)
Put b=80
We get:
\(\Rightarrow80=\frac{10}{9} t+30\\\Rightarrow 50=\frac{10}{9}t\\\\\Rightarrow t=45 \text{min}\)
∴ It will take (45-36)=9 more minutes to reach 80% battery.
#SPJ2
.
__________ line(s) indicates passing is allowed if there are no oncoming cars.
A solid yellow
Double solid yellow
Broken white
Broken yellow
Click this link to view O*NET’s Tasks section for Financial Analysts. Note that common tasks are listed toward the top, and less common tasks are listed toward the bottom. According to O*NET, what are some common tasks performed by Financial Analysts? Check all that apply.
drawing charts and graphs to illustrate reports
comparing insurance policies to determine the best choice
informing investment decisions by analyzing financial information
investigating cases of fraud
helping families create realistic budgets
Answer:
drawing charts and graphs to illustrate reports
informing investment decisions by analyzing financial information
Explanation:
She's right: SORRY BUT I NEED TO WRITE AT LEAST 20 CHARACTERS FOR THE ANSWER
Read the following paragraph from the article "How Social Stress Makes Your Brain Vulnerable to Depression," written by
Andy Coghlan in the online edition of New Scientist magazine, published on November 13, 2017:
Social stress can trigger changes in the brain that open the door to depression. Experiments in human brains and mice
suggest that experiences such as bullying make the blood-brain barrier leaky, letting inflammation into the brain and altering
mood.
Which of the options below most correctly and effectively incorporates this source material? (Either APA or MLA style citations
are acceptable.)
Bullying makes your brain leak, according to a shocking new study reported in New Scientist (Coghlan, 2017)!
O
In "How Social Stress Makes Your Brain Vulnerable to Depression," Andy Coghlan (2017) explains how "brains and
mice" can develop depression in unpleasant social situations.
The study shows that emotional experiences can cause physical changes in the brain that lead to depression. (Coghlan,
2017).
O Coghlan (2017) describes how stress can spark changes in the brain that open the way to depression.
The most appropriate option that effectively incorporates the source material is: Coghlan (2017) describes how stress can spark changes in the brain that open the way to depression.
How is the article written?In his 2017 article titled "The Link Between Social Stress and Depression," Andy Coghlan explores the correlation between these two factors impacting brain vulnerability.
According to Coghlan, the brain can undergo alterations as a result of events such as bullying, which can cause the blood-brain barrier to become permeable and enable inflammation to enter.
The change in brain activity has the potential to impact emotions and may lead to the onset of depression. Cognizant of the effects of emotional encounters on brain structure, Coghlan's discoveries underscore the correlation between social pressure and mental health ailments.
Read more about source materials here:
https://brainly.com/question/2772106
#SPJ1
1356036189+123342345
Answer:
1479378534
Explanation:
i added
identify various limiting factors (abiotic and biotic) in an ecosystem
Answer:
Explanation:
In ecology, biotic and abiotic factors make up an ecosystem. Biotic factors are the living parts of the ecosystem, such as plants, animals, and bacteria. Abiotic factors are the nonliving parts of the environment, such as air, minerals, temperature, and sunlight. Organisms require both biotic and abiotic factors to survive. Also, a deficit or abundance of either component can limit other factors and influence an organism's survival. The nitrogen, phosphorus, water, and carbon cycles have both biotic and abiotic components.
Answer:
Biotic factors are living things within an ecosystem; such as plants, animals, and bacteria, while abiotic are non-living components; such as water, soil and atmosphere. The way these components interact is critical in an ecosystem. Thus, organisms tend to compete for their limited availability in the ecosystem. Different limiting factors affect the ecosystem. They are (1) keystone species, (2) predators, (3) energy, (4) available space, and (5) food supply. Some examples of limiting factors are biotic, like food, mates, and competition with other organisms for resources. Others are abiotic, like space, temperature, altitude, and amount of sunlight available in an environment. Limiting factors are usually expressed as a lack of a particular resource.
Mark brainiest
1. Use hollow blocks for constructions such as_____________.
2. Concrete hollow blocks are made from ________________ and cement to be formed into sizes.
3. The bricks are made from ______ and other materials.
4. Place the newly formed blocks into ______ to dry and solidify
5. Bricks are placed into _________ where high temperature bakes the materials.
6. The _________ are loose particle commonly found near the shorelines.
7. Gravel are loose ______________of rock fragments.
8. Steel square / try square is used to check ___________________.
9. Bolts and nuts can be tighten and loosen using ________.
10. Only qualified __________________ is allowed to work in concrete operations
11. Always consult to drawing _______ when working with masonry operations
12 The vertical alignment of scaffold is checked using ______________________.
13. Never use _______________ water in concrete mixture.
14. Cement is a combination of ___________ and aluminates.
15. We use ___________ in mixing large amount of mortars.
Mason Plumb bob PPEs Fine Aggregates
Spade ScaffoldBolts & nuts
UncleanAggregates Spirit Level Bar
PlatformLumber Oven
Wrench Squareness Sun heat
Plan Walls Hard & even
Answer:Use hollow blocks for constructions such as walls, partitions, fences, and other load-bearing structures.
Concrete hollow blocks are made from fine aggregates (such as sand) and cement to be formed into various sizes.
The bricks are made from clay and other materials.
Place the newly formed blocks into a curing area to dry and solidify.
Bricks are placed into an oven (or kiln) where high temperature bakes the materials.
The aggregates are loose particles commonly found near the shorelines.
Gravel is a loose collection of rock fragments.
Steel square / try square is used to check the squareness and accuracy of corners and angles.
Bolts and nuts can be tightened and loosened using a wrench.
Only qualified masons or personnel with proper training and certification are allowed to work in concrete operations.
Always consult the drawing or blueprint when working with masonry operations to ensure accuracy and compliance with design specifications.
The vertical alignment of the scaffold is checked using a spirit level or plumb bob.
Never use unclean water in the concrete mixture to avoid compromising the quality of the material.
Cement is a combination of calcium silicates and aluminates.
We use a platform or lumber in mixing large amounts of mortars to facilitate the process and ensure even mixing.
if someone is having a seizure with loss of consciousness, one of the first things you should do is turn the person on her/his side.
If someone is having a seizure with loss of consciousness, one of the first things you should do is turn the person on her/his side then turn the person with his side if they are not awake and aware.
Given that if someone is having a seizure with loss of consciousness.
We are required to tell what we should do is turn the person on her/his side.
A seizure is basically a sudden, uncontrolled electrical disturbance in the brain. It can cause changes in our behavior, movements or feelings, and in levels of consciousness. If we have two or more seizures at least 24 hours apart that aren't brought on by an identifiable cause is generally considered to be epilepsy.
Hence if someone is having a seizure with loss of consciousness, one of the first things you should do is turn the person on her/his side then turn the person with his side if they are not awake and aware.
Learn more about seizure at https://brainly.com/question/2375809
#SPJ4
Which statement BEST explains how the structure
of the entire passage influences the reader?
Multiple paragraphs lead the reader to understand
that this is a complex problem.
Chronological descriptions of events help the
reader understand how the problem started.
Comparisons help the reader imagine what the
garbage patch looks like.
Questions in subheadings engage the reader in the
content of each section.
In the figure below, AB=BC, What is the area of triangle ABC? Studying for ACT please help
Answer:
The area of ΔABC = 25 (E)
Explanation:
⭐What is the formula for the area of a triangle?
\(area = \frac{1}{2}(bh)\)b = base of the triangleh = height of the triangleIf AB = BC, then BC = \(5\sqrt{2}\).
If BC = \(5\sqrt{2}\), then ∠A = 45°.
Utilize the triangle sum theorem to solve for ∠B.
⭐What is the triangle sum theorem?
the sum of all the angles of a triangle equals to 180 degrees∠A + ∠B + ∠C = 180
45 + ∠B + 45 = 180
90 + ∠B = 180
∴ ∠B = 90
This means that ΔABC is a right triangle.
If ΔABC is a right triangle, then BC is the height of the triangle, because it is the altitude that forms a 90 degree angle.
If ΔABC, then AB is the base of the triangle.
Thus, we need to solve for BC, substitute it into the area formula, and solve for the area.
To find an unknown side length, we use trigonometric functions.
⭐What are trigonometric functions?
ratios of side lengths in respect to an angle in order to find an unknown side length⭐What are the types of trigonometric functions?
sin(θ) = opposite/hypotenusecos(θ) = adjacent/hypotenusetan(θ) = opposite/adjacentTo determine which trigonometric function we use, we need to see the type of side lengths we are given (adjacent, opposite, or hypotenuse).
We are given side length AB, which is adjacent to ∠A.
We want to find side length BC, which is opposite of ∠A.
∠A = 45 degrees.
Therefore, we will use tan(θ).
Substitute the values of the side lengths and angle measure into tan(θ):
\(tan(x) = \frac{opposite}{adjacent}\)
\(tan(45) = \frac{BC}{5\sqrt{2}}\)
Compute using the trigonometric table (i attached it to this response):
\(tan(45) = \frac{BC}{5\sqrt{2}}\)
\(1 = \frac{BC}{5\sqrt{2}}\)
\(5\sqrt{2} = BC\)
∴ BC, the height, = \(5\sqrt{2}\)
Substitute the values of the base and the height into the area formula, and solve for the area:
\(area = \frac{1}{2}(bh)\)
\(area = \frac{1}{2}(5\sqrt{2}*5\sqrt{2})\)
\(area = \frac{1}{2}(50)\)
\(area = 25\)
∴ The area of ΔABC = 25
Good luck on your ACT! You are going to do great :)
If this response helped you, please give me a brainly.
The breaking strengths of cables produced by a certain manufacturer have a standard deviation of 92 pounds. A random sample of 90 newly manufactured cables has a mean breaking strength of 1700 pounds. Based on this sample, find a 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer. Then give its lower limit and upper limit. Carry your intermediate computations to at least three decimal places. Round your answers to one decimal place
Answer:
To find the 95% confidence interval for the true mean breaking strength of all cables produced by the manufacturer, we can use the formula:
Confidence Interval = Sample Mean ± (Critical Value * Standard Error)
First, let's calculate the standard error, which is the standard deviation divided by the square root of the sample size:
Standard Error = Standard Deviation / √(Sample Size)
= 92 / √(90)
≈ 9.685
Next, we need to determine the critical value corresponding to a 95% confidence level. Since the sample size is large (n > 30), we can use the z-table. The z-value for a 95% confidence level is approximately 1.96.
Now we can calculate the confidence interval:
Confidence Interval = Sample Mean ± (Critical Value * Standard Error)
= 1700 ± (1.96 * 9.685)
Lower Limit = 1700 - (1.96 * 9.685)
≈ 1679.69
Upper Limit = 1700 + (1.96 * 9.685)
≈ 1720.31
Therefore, the 95% confidence interval for the true mean breaking strength of all cables produced by this manufacturer is approximately (1679.7, 1720.3). The lower limit is 1679.7 pounds, and the upper limit is 1720.3 pounds.
Cole is doing a basketball challenge for charity. In order to win money for the charity, he needs to score at least
20 points in less than 10 shots. If x is the number of 2-point shots, and y is the number of three point shots, which
inequalities below represent the situation?
Explanation:
x + y < 10
2x + 3y ≥ 20
Which graph best represents the relationship between the acceleration of an object falling freely near the surface of earth and the time that it falls?
Answer:
Explanation:
The graph that best represents the relationship between the acceleration of an object falling freely near the surface of the earth and the time that it falls is a straight line graph with a positive slope.
According to the laws of physics, when an object falls freely near the surface of the Earth, it experiences a constant acceleration of approximately 9.8 meters per second squared (m/s^2), which is also known as the acceleration due to gravity. This means that the acceleration of the object is constant over time and does not change.
Therefore, the graph of acceleration versus time for an object falling freely near the surface of the Earth will be a straight line with a positive slope, starting at an acceleration of 9.8 m/s^2 at time zero and continuing with the same slope throughout the fall. The x-axis will represent time, while the y-axis will represent acceleration in m/s^2.
where do tornadoes most often occur in the United States
Answer:the Great Plains of the central United States
Explanation:
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
Every company should plan to deliver _____.
Answer:
Explanation:
Good services to the customer
please someone help me!!
In parallel circuits, ______ follow down ______ paths.
protons, single (A)
electrons, single (B)
electrons, multiple (C)
protons, multiple (D)
In parallel circuits, electrons follow down multiple paths: C. electrons, multiple.
An electric circuit can be defined as an interconnection of electrical components which creates a path for the flow of electric current (electrons) due to a driving voltage.
Basically, the components of an electric circuit can be connected or arranged in two forms and these are;
Series circuitParallel circuitA parallel circuit refers to an electrical circuit that has the same potential difference (voltage) across its terminals. Thus, its components are connected within the same common points, so that only a portion of current (electrons) flows through each branch and in multiple paths.
Consequently, current (electrons) can flow in multiple paths due to the presence of a branch in the parallel circuit and as such, one branch is independent of the other.
In conclusion, electrons follow down multiple paths in a parallel circuit.
Read more: https://brainly.com/question/23088951