board. [bord]. noun. [From Middle English bord, a piece of sawed lumber or a border]. 1. A piece of sawed wood that is longer than it is thick. 2. A group of people who have managerial or advisory power. 3. A flat, rectangular surface. 4. Food provided in exchange for pay. Identify the definition of board used in each sentence. The board vetoed the decision. That college makes all first-year students pay for room and board.

Answers

Answer 1

The definition of board that is used in the first sentence is A group of people who have managerial or advisory power while the definition of board that is used in the second sentence is Food provided in exchange for pay.

The word board is known to mean several things. Board could mean a piece of flat wood.

The word could also mean getting on a means of transport such as a bus or an aero plane.

Board could also mean a group of individuals that are at the helm of affairs in an organization.

With these definitions, the board that can veto decisions is one that has managerial or advisory power.

While the board that makes students pay for room is food that is exchanged for pay.

In conclusion options 2 and 4 are the definitions of board used in both sentences.

Read more on https://brainly.com/question/11085218?referrer=searchResults

Answer 2

Answer:

2 and 4

Explanation:


Related Questions

Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1

1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt


Part 2

1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)

Part 3

Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms







Part 4

Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.


Part 5

Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.

Answers

The appropriate verbs for the given sentences are given below:

Part 1

waswas lyingwouldfeels

Part 2

were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould be

Part 3

hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshave

Part 4

1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.

Part 5

itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheir

What is a Verb?

This refers to the part of speech that shows action in a given sentence.

Hence, the words have been correctly selected above from the four different parts of the question.

Read more about verbs here:

https://brainly.com/question/1718605

#SPJ1

George reads 11 pages of a book each day.
How many pages will he read in 5 days?
56
B
55
с
16
6

George reads 11 pages of a book each day.How many pages will he read in 5 days?56B55166

Answers

Answer:

55

Explanation:

11 x 5 = 55

Answer is 55 because 11 x 5 = 55

After studying until four in the morning, I was a bit sleepy
is this a
paradox
understandment
hyperbole
verbal irony

Answers

Answer:

understandment or anything

This is an understatement.

In a later post of yours, I explain what a paradox, understatement, hyperbole, and verbal irony are.
I hope it helps!

What are some advantages of the 529 college savings plan?

Answers

Answer:

Tax benefits. Investing in a 529 plan has a range of tax benefits. ...

Low Maintenance. ...

High Contribution Limits. ...

Favorable Financial Aid Treatment. ...

Flexibility. ...

Penalty for Non-Qualified Withdrawals. ...

State Income Tax Recapture. ...

Limited Investment Choices.

what are two cryptocurrencies and explain what they are in 250 words each

Answers

Answer:

Bitcoin

Ethereum

Explanation:

A digital coin is created on its own blockchain and acts in much the same way as traditional money.

An adolecent female arrive in the emergency department after a phyical aault. The upected attacker wa alo brought to the hopital for treatment of injurie. A male health care provider i aigned to examine the client. Which action would bet protect the client' right during the phyical examination?

Answers

Answer:

An adolescent female arrives in the emergency department after a physical assault. How could the male nurse best protect the client's rights during the physical examination?

Definition

1 / 158

Have a female health care worker present.

A female health care provider should be present to observe an examination performed by a male health care provider. Leaving the door open and informing the client's friends about her condition violates her right to privacy and confidentiality. Although the suspected attacker should be kept away from the examination room, having a female health care worker present during the examination best protects the girl's rights.

Explanation:

What is a goal of the mission of the James Webb Space Telescope?

to find evidence of life on Mars

to study how solar flares of our sun affect Earth

to find evidence of events in the history of the universe

to study how Venus and Earth diverged as planets

(33 points)

Answers

Answer:

to find evidence of events in the history of the universe

Explanation:

A goal of the mission of the James Webb Space Telescope is to find evidence of events in the history of the universe.

The correct answer to the given question is option C.

The James Webb Space Telescope has several objectives and goals, with the primary aim of its mission being to identify the events that led to the formation of the universe.

In addition, it aims to collect data on various galaxies, stars, and planets that will help scientists determine the evolution of these entities.The primary objective of the James Webb Space Telescope is to identify the early universe's formation by collecting data on the stars, galaxies, and planets.

It is also aimed at gathering data on various celestial objects such as exoplanets and black holes.The James Webb Space Telescope aims to collect data that will allow astronomers to determine the events that led to the formation of the universe.

It will collect data on distant galaxies, stars, and planets to provide insights into the evolution of these entities. The telescope will have advanced capabilities such as infrared vision that will allow it to collect data on some of the universe's earliest structures.

Additionally, the James Webb Space Telescope aims to collect data on exoplanets, which could provide insights into how life in the universe developed. The telescope's ability to identify the atmospheric composition of exoplanets will be crucial in determining their habitability.

Ultimately, the telescope's primary goal is to contribute to the advancement of our understanding of the universe.

For more such questions on James Webb Space Telescope, click on:

https://brainly.com/question/8962979

#SPJ8

A piece of wood ha a ma of 303030 gram (\text{g})(g)left parenthei, tart text, g, end text, right parenthei and a volume of 404040 cubic centimeter \left(\text{cm}^3\right)(cm
3
)left parenthei, tart text, c, m, end text, cubed, right parenthei. A econd piece of wood ha the ame denity \left(\dfrac{\text{g}}{\text{cm}^3}\right)(
cm
3

g

)left parenthei, tart fraction, tart text, g, end text, divided by, tart text, c, m, end text, cubed, end fraction, right parenthei and a volume of 240\ \text{cm}^3240 cm
3
240, pace, tart text, c, m, end text, cubed. What i the ma, in gram, of the econd piece of wood?

Answers

According to the question,The ma of the second piece of wood i 7272727 gram (\text{g})(g).

What is the piece?

The piece is a musical composition that has been written by a composer. It is typically composed of a melody, harmony, and rhythm. The melody is the main component of the piece, and it is generally the most recognizable part. The harmony is the accompaniment to the melody, and it can be written in any style of music. The rhythm is the beat and tempo of the piece, and it is usually determined by the instrumentation and other elements like dynamics. The piece can be performed by a single performer or multiple performers, and can be composed for many different instruments or voices. The length of the piece can vary, and it can be a single movement or multiple movements. Overall, the piece is an art form that expresses creativity and emotion.

To learn more about piece

https://brainly.com/question/27441596

#SPJ4

Which properties most likely belong to a metal?
A. brittle and dull
B. liquid and clear
C. ductile and malleable
D. gaseous and unreactive

Answers

Answer:

the properties are ductile and malleable

Predict the amount of profit, in dollars, the district office will make if 1,200 people attend the School Fair.

Predict the amount of profit, in dollars, the district office will make if 1,200 people attend the School

Answers

Based on the table, the school fair makes $100 per person in attendance. If 1,200 people attend, the school fair will make $120,000.

The school district office uses 70% of this money for maintenance costs and other expenses, leaving 30% for profit.

Therefore, the school district office will make a profit of $36,000 if 1,200 people attend the school fair.

How to calculate the amount

Total money made from the school fair: $120,000

Amount used for maintenance costs and other expenses: 70% * $120,000 = $84,000

Here is the formula for calculating the profit from a school fair:

Profit = Total amount of money made from the fair - Amount used for maintenance costs and other expenses

In this case, the profit is calculated as follows:

Profit = $120,000 - $84,000 = $36,000

Profit: $120,000 - $84,000 = $36,000

Learn more about profit on

https://brainly.com/question/1078746

#SPJ1

A fish tank in a pet store was less than half full of
water when a worker turned on a hose to fill the
tank at a constant rate. After the hose was on for
5 minutes, the tank was exactly half full. After
the hose was on for 30 minutes, the tank was
three-quarters full. How many minutes did it take
after the hose was turned on for the tank to be
completely filled with water?

Answers

100 minutes

During 25 minutes, it got filled 1/4 more (3/4 - 1/2)

So it would take 100 minutes to completely fill it

According to Newton's 3rd Law of Motion, when you walk on the sidewalk, the push of your shoe on the ground is _______ the push of the ground on your shoe. *

Answers

Answer:

opposite

Explanation:

Newton's 3rd law of motion: If object A exerts a force on object B, then object B must exert a force of equal magnitude and opposite direction back on object A.

so it should be opposite because the ground/floor pushes the shoe up and forward, the shoe pushes down and back.

correct me if you see a mistake.

I will give you 30 points if you select me as the brainliest

Answers

Ok......................

Answer:

Fine! You're the smartest. Is that all right?

A student raises the possibility that a single clip containing an unusually high number of emotional
words could have a disproportionate influence on
Sun's team's measurement of that participants emotional word use. Which choice best supports the idea that Sun's team accounted for this possibility in the design of the study?
A) Lines 26-29 ("The team ... words*)
B) Lines 29-35 ("They ... topics")
C) Lines 35-40 ("Finally ... mood")
D) Lines 41-44 ("The researchers... mood")

Answers

Note that the  choice best supports the idea that Sun's team accounted for this possibility in the design of the study is: "B) Lines 29-35 ("They ... topics")" (Option B).

Why is this so?

Based on the information provided, option B) Lines 29-35 ("They ... topics") best supports the idea that Sun's team accounted for the possibility of a single clip containing an unusually high number of emotional words.

This is because these lines explain how the team selected video clips that represented a range of emotional topics and intensities. By doing so, they ensured that the emotional content of any single clip would not unduly influence the measurement of emotional word use for a particular participant.

Option A) Lines 26-29 ("The team ... words") introduces the study's objective of measuring emotional word use but does not address the concern raised by the student.

Option C) Lines 35-40 ("Finally ... mood") and option D) Lines 41-44 ("The researchers... mood") discuss the potential influence of mood on emotional word use but do not directly address the concern about a single clip containing an unusually high number of emotional words.

Learn more about study design:

https://brainly.com/question/31147631

#SPJ1

Some forestry professions work for logging companies

True or false

Answers

Answer:

true

Explanation:

Answer:

true

Explanation:

State 4 physical properties of non metals.​

Answers

Answer:

Physical Properties of Nonmetals

Nonmetals have high ionization energies. They have high electronegativities. Nonmetals are insulators which means that they're poor conductors of electricity. They are dull, they do not have lustre like metals.

mark me brainliest pls

Please Answer this I will give points please give me explanation too?

Please Answer this I will give points please give me explanation too?

Answers

Answer:3rd option

Explanation:

we know if, \(a^{b}*a^{c} =a^{b+c} \\a^{b}/a^{c} =a^{b-c}\)

by using that,

\(4^{2/6+2/6-5/6}=4^{\frac{-1}{6} }\\\\(4^{\frac{-1}{6} })^{\frac{3}{11} } =4^{\frac{-3}{66} }\\\)

Given a fixed amount of gas held at constant pressure, calculate the volume it would occupy if a 3. 50 l sample were cooled from 90. 0oc to 30. 0oc.

Answers

Answer:

I genuenly don't know

Explanation:

Andrew attends a school that is based on the teaching of religious leader. What kind of school does he attend?

Answers

The answer Catholic school

Determine the value of y.
GET !^ POINT HELP ASAAAAAAAAAPPPPPPPPP
I NEEEED HELPPPPPPP

Question 2 options:

A)

13.3

B)

1.875

C)

4.8

D)

3

Determine the value of y.GET !^ POINT HELP ASAAAAAAAAAPPPPPPPPPI NEEEED HELPPPPPPPQuestion 2 options:A)

Answers

The answer should be c)4.8

On the ACT reading section, you will be asked to:
A. make a list of the publication dates for certain classic novels.
B. make generalizations about passages based on the specifics
provided in them.
O C. name the styles of different poems.
D. identify authors from excerpts of their work.

Answers

Answer: B. make generalizations about passages based on the specifics

Explanation: The ACT reading section assesses your ability to comprehend and analyze written passages.  You will encounter various passages from different genres, such as fiction, non-fiction, social sciences, and humanities.  The questions in this section will require you to draw conclusions and make inferences based on the details and information provided in the passages.

In addition, you will be asked to make generalizations about the passages, which means you will need to identify overarching themes, main ideas, or the author's purpose.  This requires careful reading and understanding of the specific details in the passage to form a broader understanding.

For example, you may be asked to determine the author's tone, identify the main conflict in a narrative, or infer the author's viewpoint on a particular issue. By analyzing the specifics in the passage, you can make logical deductions and draw conclusions that demonstrate your comprehension and critical thinking skills.

The density of mercury is______g\cm3.

Answers

Answer:

The answer to the question is 13.6g/cm^3

Answer:

13.6

Explanation:

You are writing a memo to staff members outlining the solution to a lingering problem. You consider the appropriate tone and word choice to win approval for your solution

Answers

The option that you consider as the appropriate tone and word choice to win approval for your solution is option B: Adapting

What is the issue about?

When writing a memo outlining a solution to a problem, it is important to use a professional and respectful tone.

This means avoiding language that may be perceived as confrontational or dismissive. Instead, try to focus on the positive aspects of the solution and how it will benefit the staff and the organization as a whole.

Therefore, in Adapting to the audience: Consider the audience for your memo and tailor your language and tone to be appropriate for them.

Learn more about Adapting from

https://brainly.com/question/25594630

#SPJ1

I mark brainliest please


Which factor do trees need when they compete for energy? soil sunlight space ability to reproduce

Answers

Answer:

Sunlight

Explanation:

Sunlight is the form of energy that trees use to complete the process of photosynthesis. In order for a tree to convert carbon dioxide and water into sugars (and other carbohydrates), it needs energy from the sun. The crown of a tree collects sunlight.

Answer:

sunlight

Explanation:

Sunlight is the form of energy that trees use to complete the process of photosynthesis. In order for a tree to convert carbon dioxide and water into sugars (and other carbohydrates), it needs energy from the sun. The crown of a tree collects sunlight.

In the interior of the Arctic islands during the melting season , even small streams must be crossed [ A ] with great care [ B ] because near - zero water temperatures and the ICI typically rocky and unstable nature of [D ] stream beds . [ E ] No error

Answers

The error in the sentence above is in: B. because near - zero water temperatures and the.

The type of error in sentences.

In English language, there are different type of error in sentences and these include:

Misplacement of the parts of speech.Incorrect subject-verb agreement.Incorrect use of antecedent.Mixing up spellings.Combining possessives and plurals.Misplaced modifiersSentence fragments.Run-on sentence or comma splice.

In this scenario, the error in the sentence above is in the word "because" near - zero water temperatures and the. Thus, it should be replaced with the phrase "due to."

Read more on sentence errors here: https://brainly.com/question/985037

#SPJ1

Vocational colleges often:
A. take longer to graduate from.
O B. require students to move far from home.
C. save students money, compared with a four-year college.
D. have few teachers.

Answers

Answer:

c

Explanation:

Vocational collages often let you graduate earlier then a regular in person collage. The average cost in a vocational school costs 33,000, which is the same cost of a single year of college; saving a hella lot. I highly doubt Vocational schools have less teachers and online schools exist so....

Vocational Colleges Save students money, compared with a four-year college.  Therefore, option (B) is correct.

Vocational colleges, also known as trade schools or technical colleges, typically offer hands-on training in a specific trade or skill. These programs are usually shorter in duration than traditional four-year colleges and universities, which can save students money on tuition and other expenses.

Additionally, vocational colleges may offer more affordable options for housing, transportation, and other expenses. While some vocational colleges may require students to move away from home, this is not always the case, and many vocational programs are available in local communities or online, allowing students to study from home.

Learn more about vocational college, here:

https://brainly.com/question/12043044

#SPJ1

Calculate the mean (average) for #1. What is the answer?

Answers

Answer:

Average means that high

Answer:

sana makatulong po ❤❤❤

Explanation:

average mean that high

The percentage decrease in mass is used to compare the results explain why

Answers

The percentage decrease is used because the difference in mass does not deal with the proportional aspect of the solutions whereas the percent is calculated to give an exact difference, including the quantities of solution.

What is the percentage decrease in mass?

Percentage decrease in mass simply means the percentage by which the mass of a substance was decreased in chemistry.

Now, the difference in mass is sometimes useful but then it does not deal with the proportional aspect of the solutions, which makes the results less accurate.

The percentage decrease in mass is usually calculated to give an exact difference while inspecting the quantities of solution.

Read more about percentage decrease in mass at; https://brainly.com/question/23885199

#SPJ1

Computer is a processing device yes or no

Answers

Answer:

yes

Explanation:

Lesson 11.1 practice a geometry answers circumference and arc length

Answers

An example of Lesson 11.1 practice a geometry question is to find the length of ∧ AB in the image attached..

What is the length of the angle about?

To be able to find the length of  (angle) ∧AB, one must:

When the Arc length of AB \(\frac{150}{360}\)

2π(5) = 13.09 meters

Therefore, the length of the angle is 13.09 meters.

Learn more about geometry  from

https://brainly.com/question/24375372

#SJ1

Lesson 11.1 practice a geometry answers circumference and arc length
Other Questions
Please help on this one!! I need it in ASAP :( question 10 I mark as brainliest help marking brainly Who painted the image above? How much does the cost increase if the number of gallons is increased from 6 to 8? 10 things that enhance the enjoyment of human rights solve the given differential equation by using an appropriate substitution. the de is homogeneous. y dx You are a civil engineer and your company wants to pursue an earthworks project. You need to buy a machine for RM 150, 000, it will bring in revenueof RM 45, 000 per year over a period of 5 years. Assume the discount rate required is 12%. Calculate the Net PresentValue (NPV) of this project and comment on the course of action to betaken.(ii) Estimate the Internal Rate of Retum (IRR) for the project using adiscount rate of 12% and 18%. PLEASE HELP! 5TH GRADE MATH! Select the best estimate of the product of 71 x 28 = ____ A. 1,300 B. 2,100 C. 3,200 D. 4,500 accelerometer assessment of physical activity in individuals with paraplegia who do and do not participate in physical exercise The man and his bicycle together weigh 200 lb. What power P is the man developing in riding Spercent grade at a constant speed of 15 mi /hr? the major part of this country is made up of the fertile plains of the tigris and euphrates. what is the country (x + 3) is a factor of the polynomial x^3 + 2x^2 - 5x + n.What is the value of n? Was the behavior of the characters in Scene 4 consistent with their behavior in the rest of the play? Why or why not? Find x. (Use pic for more info) gina and lauren are sisters. gina is in 12th grade, and lauren is in 10th grade. which one of these girls is likely to work more hours at her part time job? The sum of three numbers is 8. The third is 9less than 8 times the second. 10 times thefirst is 7 less than 8 times the second. Findthe numbers. find iterations with the inverse power method to find the approximate smallest eigenvalue and its cawesponding eigenvector. * in matlab 2 A { = ( -13) = 12 -5 mr. sampson's mouth always waters when he eats a donut. he nearly always orders a coffee when he has a donut. one day, he orders a coffee and a chocolate donut. he is served the coffee right away, but told that the donuts are still being made and he will have to wait a few minutes. he takes a seat while he is waiting and takes a deep sniff of his coffee. as he does so, he begins salivating. in terms of classical conditioning, why did this happen? Somerset leasing received $28,800 for 12 months' rent in advance. how should somerset record this transaction?