The entity that I would you recommend for this engagement is APN Consulting Partner
What is Cloud Computing?This refers to the availability of system resources that can be accessed from anywhere and is stored in the cloud.
Hence, we can see that based on the fact that the multi-national corporation wants to get professional advice on how to move their apps through the cloud, they should contact APN Consulting Partner.
Read more about cloud computing here:
https://brainly.com/question/19057393
#SPJ1
The Framers of the Constitution gave specific powers to both the nation as well as individual states. Explain why printing currency is a delegated power. What problems would arise if each state was able to print their own money?
Answer:
Printing currency is a delegated power assigned to the federal government under the Constitution. The Framers recognized the importance of a uniform national currency to facilitate commerce, promote economic stability, and prevent inflation. Allowing states to print their own money could cause confusion, inflation, and fraud, and undermine the stability of the national economy. Hence, the power of currency printing is delegated to the federal government to maintain uniformity and stability in the economy.
A sailboat travels a distance of miles in of an hour. Which complex fraction represents the unit rate in miles per hour?
help
Answer: A sailboat travels a distance of miles in of an hour. Which complex fraction represents the unit rate in miles per hour?
Explanation:
Answer:
A sailboat travels a distance of 2 1/2 miles in 1/6 of an hour.
Step-by-step explanation:
im built different
Propose two strategies matriculants could put into place to adapt to possible changes in the world of work. In your answer also indicates how each proposition could lead to less stress during this time of change being part of the work force
C4Lcademy
Answer
I need to past plz
how do i get here for english
riddle
-what has many keys but cant open a single lock?
Answer:
padlock. i have no idea
im freaking stupid
It's a piano (edited: oh i am right i truly know this one earlier just saw it and i wanted to answer)
Marianna is working on improving her communication skills. To be a good listener she should.
An argument in science is most like a
In regards to the above, An argument in science is most like a debate.
What is a scientific argument?An argument is known to be a kind of a disagreement that tend to exist between people about it is one where the said issue is one that the people feel is important.
Note that A scientific argument is set as people who are known to be disagreeing in regards to scientific explanations (claims) and it is one where there is the use of empirical data (evidence) to be able to clarify or justify one's side of the argument.
Debate is an act where there is a kind of formal discourse on a given topic, and as such, An argument in science is most like a debate.
Learn more about argument from
https://brainly.com/question/1223442
#SPJ1
See full question below
An argument in science is most like a _______________________________.a. competition b. debate c. fight d. yelling match
HELPPPP me please quick
Distributive property
Combine like terms
I don't know the rest
how do i fix a broken heart
Smaller particles moved by the wind occurs through deflation.
Answer:
The answer would be true!
Explanation:
As smaller particles moved by the wind occurs through deflation.
hope it helps!
why is Pluto called a ,"dwarf planet" ?
Answer:
Pluto is called a dwarf planet because it does not meet the three criteria set forth by the International Astronomical Union (IAU) for a full-sized planet.
These criteria are:
It must be in orbit around the Sun.It must be massive enough for its self-gravity to overcome rigid body forces so that it assumes a hydro-static equilibrium (nearly round) shape.It has cleared the neighborhood around its orbit.Pluto meets the first two criteria, but it does not meet the third. The Kuiper Belt is home to many other objects that are similar in size to Pluto, and these objects share Pluto's orbit. This means that Pluto has not cleared its neighborhood of other objects, as a planet is supposed to do.
As a result of this, Pluto was reclassified as a dwarf planet in 2006. There are now five dwarf planets in our solar system: Pluto, Ceres, Eris, Makemake, and Haumea.
Answer and Explanation:
Pluto is called a "dwarf planet" because it does not meet the criteria to be classified as a full-fledged planet. In 2006, the International Astronomical Union (IAU) redefined the definition of a planet, which led to Pluto being reclassified as a dwarf planet. Here are the main reasons why:
1. Size: While Pluto is larger than some moons in our solar system, it is much smaller than the eight traditional planets like Earth, Jupiter, and Saturn. Its size is comparable to other objects in the Kuiper Belt, a region beyond Neptune where many icy bodies reside.
2. Orbit: Unlike the eight planets that have relatively clear paths around the Sun, Pluto has a more elongated and inclined orbit. This means it has a more irregular path and crosses the orbit of Neptune at certain points. This is different from the regular, more circular orbits of the traditional planets.
3. Neighborhood: Pluto is part of a region called the Kuiper Belt, which consists of numerous icy bodies and small objects. This region is distinct from the inner solar system where the eight traditional planets reside. The presence of many similar-sized objects in its vicinity further influenced the decision to reclassify Pluto.
By considering these factors, the IAU determined that Pluto did not meet the criteria to be classified as a planet. Instead, it was designated as a dwarf planet, a new category that acknowledges its unique characteristics and its place in the Kuiper Belt.
It's important to note that this reclassification sparked some debate and controversy among astronomers and the public. However, the IAU's decision to classify Pluto as a dwarf planet is the current scientific consensus.
What is the overall controlling idea throughout the paragraph? Young students should compete in varsity athletics. Students learn about themselves by taking risks. Students benefit from high-level competition. Young students are nervous during tryouts.
Answer:
Students learn about themselves by taking risks.
Explanation:
Students will better from failure and risks then hand-outs
As per the paragraph of the main idea is that of the learning to take risks from taking a part in the program.
The controlling ideas include risk-seeking behavior and the ability to manage it.Hence the option B is correct.
Learn more about the controlling idea throughout the paragraph.
brainly.com/question/13231011.
r agtfhhhdfggggggggggggggggddddddddg
Answer:
what is this? ha..........
Fear of failure, peer pressure, and personality conflicts are examples of
Fear of failure, peer pressure, and personality conflicts are examples of: reasons employees resist to change.
Who is an employee?An employee refers to an individual who is employed by an employer of labor in a business firm (organization), so as to perform specific tasks, duties or functions on a daily basis.
This ultimately implies that, an employee is saddled with the responsibility of providing specific duties, functions, or services to his or her employer for a certain agreed fee, that is usually paid at the end of the month.
Basically, some example of the reasons why employees resist or are indifferent to change within a business firm (organization) include the following:
Fear of failurePeer pressurePersonality conflictsUnemploymentRead more on employees here: https://brainly.com/question/26548590
A biologist studying caterpillars finds that one caterpillar is 2.78 centimeters long and a second one is 3.1
centimeters long. the second caterpillar is how many centimeters longer than the first caterpillar?
Answer:
the second one is 0.32 centimeters long
because we subtract the length of the first one from the second
so we have 3.1-2.78
The image displays a structure of fungi. Which of the following best describes the function of the structure displayed in the image below?.
The image attached below displays a structure of fungi whose function is meant for water absorption.
What are Fungi?
Fungi is a small, thin filament found in fungi, plants, and sponges that binds the organism's developing (i.e. the vegetative) body to a substrate surface layer that is capable of collecting nutrients (e.g organic materials, water, etc.).
The image displayed below shows a rhizoid with a root-like structure(root hairs) found in fungi that aid in the absorption and retention of water from the rhizosphere.
Learn more about Fungi here:
https://brainly.com/question/10878050
Answer spore production
The photo is in black and white and shows a mushroom-looking object and a bunch of circular objects above it just. Off that photo, it should help you determine the answer.
What would win? A shark or a poisonous frog?
Answer:
Shark
Explanation:
A shark would just eat the frog.
This question said Poisonous meaning if it bit you.
if the frog was venomous then when the shark ate it the shark would die.
however you said poisonous, so the shark will win
his name can be carl
Describe the wastewater treatment that occurs at the Back River Wastewater Treatment Plant
The Back River Wastewater Treatment Plant utilizes a multi-step process to treat wastewater. It includes physical, biological, and chemical treatments to remove contaminants, reduce pollutants, and produce treated water that meets regulatory standards for discharge into the environment.
What is wastewater treatment?Wastewater treatment is the process of removing and eliminating impurities from wastewater and convertingit into effluent that may be recycled into the water cycle.
When returned to the water cycle,the effluent has a low environmental impact or is utilised for other uses.
Learn more about wastewater at:
https://brainly.com/question/13348717
#SPJ1
how do you think khanyi's relationship with her mother has been affected by the role that khanyi has to play
It may be inferred that when the reality program first aired, Khanyi and Khanz's relationship was rocky to say the least. Khanyi had left Khanz to straddle between boarding school and her mother's residence in an attempt to recapture her status.
When the show first aired, it seemed that Khanz knew Khanyi as well as a fan would—through television and social media posts. But it didn't take long for their relationship to grow.
What is an inference?Inferences are processes in thinking that move from premises to logical conclusions; the word infer is etymologically related to "carry forward." Theoretically, inference is typically separated into deduction and induction.
A person is considered to have drawn an inference when they reach a conclusion by combining one or two logical facts.
Learn more about inference:
brainly.com/question/25280941
#SPJ1
An associates degree earns a yearly median salary of
A.$39,052
B. $44,096
C. $64,272
D. $81,172
Help me!!
Answer: $46,124 per year
Explanation:
thats the real rate of how much they earn but if it forces you two pick one try b.
Which best describes the process that should be followed when creating a fitness goal?.
Answer:
making a diet plan cut the amount of food you eat and start working out daily
Explanation:
pls what is 3+5 pls hurri
Answer:
8
Explanation
This answer would be 8.
5 dollars with 3 more dollars equals 8 for example
A] Sarah wanted to know if water boils faster when salt is added to it. She put two liters of water in
two identical pots, then added three tablespoons of salt to one pot. She put both pots on a stove, each on high
heat. She then recorded how long it took for each pot of water to boil. What is the independent variable in this
experiment?
A) the amount of water in each pot
B) the type of pots used
C) the amount of salt in each pot
Answer:
c probly
Explanation:
Can anyone give me a test file or something to practice for the SAT test i could really use it
https://learn.khanacademy.org/osp-landing-page/?utm_source=cb-practicetestpage&utm_medium=cb418-cb&utm_campaign=osp-lp
There´s the link to the practice test! :)
his image shows the rock cycle.
The Rock Cycle. Arrows point from 1 stage to next. 1. Metamorphic Rock to point K to Magma to point V to Igneous Rock to Melting back to magma. 2. Metamorphic Rock to point K to Magma to point V to Igneous Rock to Heat and Pressure. 3. Metamorphic Rock to point K to Magma to point V to Igneous Rock to Weathering and Erosion to Sediment to Compacting and Cementing to Sedimentary Rock to Heat and Pressure to Metamorphic Rock. 4. From Sediment to Compacting and Cementing to Sedimentary Rock to Weathering and Erosion back to Sediment. 5. Metamorphic Rock to Weathering and Erosion to Sediment.
Which event most likely occurs at point K?
cooling
cementing
melting
weathering
Answer:
melting?
Explanation:
metamorphic rocks melt to become magma
Answer:
The answer is melting
Explanation:
I took the test on Edge 2020 and got the answer right.
giving away all points because brainly is glitchy
Answer:
thanks j
Explanation:
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
cuál sería mi misión si fuera un emprendedor de criaderos de pollo
La respuesta correcta para esta pregunta abierta es la siguiente.
A pesar de que no se anexan opciones o incisos para responder, podemos comentar lo siguiente.
La respuesta correcta para esta pregunta abierta es la siguiente.
¿Cuál sería mi misión si fuera un emprendedor de criaderos de pollo?
Tu misión en esta vida si fueras un emprendedor o empresario que administrara criaderos de pollos sería la de brindar una fuente permanente de alimentación para la región en la que habitas, procurando una cría higiénica, de trato apropiado para los animales, para que sirvan de fuente nutricional para los consumidores debido al elevado número de nutrientes de tus pollos.
Como ganadero y criador de pollos, deberás procurar alimentar sanamente a tus pollos para que crezcan sanos y fuertes y sean un alimento de calidad para la nutrición de tus consumidores.
This graph shows the US unemployment rate from August 2010 to November 2011.This graph could help an economist predict
Answer:
c. how many people will be out of work in the next year.
Complete Question:
This graph shows the US unemployment rate from August 2010 to November 2011.
This graph could help an economist predict:
a. how the government will address unemployment.
b. which industries are most in need of workers.
c. how many people will be out of work in the next year.
d. why producers might hire fewer workers in the future.
Hope I helped!