2+2 equals what any answer is ok

Answers

Answer 1
4, could you mark brainliest?

Related Questions

Kayleen buys one 3 -pound bag of cat food. Her cat eats about 34 of a pound every week. How many weeks does one bag last?

Answers

if you mean 3/4 of a pound then each bag would last about 4 weeks
The answer is 3 weeks

X Y
-7 0
0 1

What is the slope of the linear function represented in
the table?
*-7
07/1
01/1
07

Answers

answer: 1/7

the formula for slope is rise over run, or y1-y2 divided by x1-x2. we can choose either number as y1 or y2 but it needs to stay consistent with x

so let’s plug in from your table.

0-1 divided by -7 -0
(you could also do 1-0 divided by 0-(-7))

-1/-7 which equals 1/7

so, your slope is 1/7

I hope this helps! :)
Answer: 1/7 Step by step explanation

Which angles are adjacent to CED? Select all that apply. 20 POINTS

Which angles are adjacent to CED? Select all that apply. 20 POINTS

Answers

EDF would be then correct answer, since they have the same angles……
EDF is the answer to this question

I need help with this plz.

I need help with this plz.
I need help with this plz.
I need help with this plz.

Answers

i don’t know if you noticed but there’s a link saying homework help. You should probably click that.
Click the link that may help.

This math equation is very confusing

This math equation is very confusing

Answers

I think its D

!Don't Attack Me If Wrong!

Select all ratios equivalent to 30:14 A. 6:4 B. 21:7 C. 60:28

Answers

Answer:

c

Step-by-step explanation:

30:14    The division isn’t proportional. 30/5 is 6 but 14/5 is not 4.

6.4

—————

30:14   Same here as above just now the 14 is proportional just not the 21.

21:7

—————

30:14     Finally! The 2nd ratio is twice the first!

60:28

Answer: hope this helps ♡

C. 60:28

Step-by-step explanation:

30:14

A. 6:4 → 30 ÷ 6 = 5 & 14 ÷ 4 = 3.5 (the answers aren't equal) 30:14 ≠ 6:4

B. 21:7 → 30 ÷ 21 = 1.4 & 14 ÷ 7 = 2 (the answers aren't equal) 30:14 ≠ 6:4

C. 60:28 → 30÷60 =0.5 & 14÷28 = 0.5 (the answers are equal) 30:14 = 60:28

Write each expression as the product of two factors.

Write each expression as the product of two factors.

Answers

Answer Which strategy would help you best in preparing for vocabulary you have never seen before? learning the prefixes of words writing a word list while you read a t...

The answer would be 4(6x6)8 and 8(5x4)9

....................

....................

Answers

Answer:

?

Step-by-step explanation:

could you please translate it for me , i’ll be more than sure to help you!

CORRET ANSWER WITH GOOD EXPLANATION WILL GET BRAINLIEST + 28 points

In the figure below, angle y and angle x form vertical angles. Angle y forms a straight line with the 60° angle and the 70° angle.

Write and solve an equation to determine the measure of angle x.

CORRET ANSWER WITH GOOD EXPLANATION WILL GET BRAINLIEST + 28 pointsIn the figure below, angle y and angle

Answers

Answer:

y = 50°, x =50°

Step-by-step explanation:

y + 70 + 60 = 180° .......straight line has 180°

y = 180° - 60° -70° =50°

x = y.......here vertical angles are always equal. So,

x = 50°

Answer:

y = 50°, x =50°

Step-by-step explanation:

y + 70 + 60 = 180° .......straight line has 180°

y = 180° - 60° -70° =50°

x = y.......here vertical angles are always equal. So,

x = 50°

Step-by-step explanation:

what value of x makes this equation true -(x+3)=2(x-3)

A. 0
B. 1
C. 2
D. 3

Answers

Answer:

To solve the equation -(x + 3) = 2(x - 3) for x, we can follow these steps:

Step 1: Distribute the negative sign on the left side of the equation:

-(x + 3) = 2(x - 3)

=> -x - 3 = 2(x - 3) (using the distributive property)

Step 2: Expand the right side of the equation:

-x - 3 = 2x - 6

Step 3: Add x to both sides of the equation to isolate the x term on one side:

-x + x - 3 = 2x + x - 6

=> -3 = 3x - 6

Step 4: Add 6 to both sides of the equation:

-3 + 6 = 3x - 6 + 6

=> 3 = 3x

Step 5: Divide both sides of the equation by 3 to solve for x:

3/3 = 3x/3

=> 1 = x

So, the correct value of x that makes the equation true is B. 1.

PLEASE MARK BRAILYISTT :D

Answer:

B, one

Step-by-step explanation:

In order to solve this, you can solve the equation. First, you can use the distributive property to get -x-3=2x-6. If you make the variables on one side and the constants on the other, you will get -3x-3=-6. This can further simplify to -3x=-6. Divide both sides by -3 to get that x=1. Then, the correct answer is B.

Reposed cause the first one didn’t have the pictures. Need help with this
Thanks :)

Reposed cause the first one didnt have the pictures. Need help with this Thanks :)
Reposed cause the first one didnt have the pictures. Need help with this Thanks :)
Reposed cause the first one didnt have the pictures. Need help with this Thanks :)

Answers

Answer:

  (d)  x = -3/4; y = -3 1/2

Step-by-step explanation:

You are asked for the coordinates of the point of intersection of the lines on the graph. This requires interpolation, because not all grid lines are marked, and the point is not on any grid line.

Interpolation

The idea of "interpolation" is figuring the value of a point that lies between points whose values are known. The answer choices here suggest that we are to interpolate to the nearest 1/4 unit. This requires that you mentally (or actually) divide the space between grid lines into 4 equal sections, and figure where the point lies relative to those divisions.

In the case of the x-coordinate, the first grid line left of the y-axis is not marked, but we notice it lies halfway between x=0 and x=-2. That means we can safely assume that the unmarked vertical grid line has a value of x=-1.

Application

horizontal coordinate

The location of the point of intersection of the two lines is horizontally closer to the -1 (unmarked) grid line than it is to the y-axis. Its x-value will be between -1 and 0. The answer choices tell us it is -3/4, consistent with it being about 3/4 of the distance toward -1 from 0.

  x = -3/4

vertical coordinate

The location of the point of intersection of the two lines is vertically about halfway between -3 and -4. The answer choices tell us it is -3 1/2.

  y = -3 1/2

The answer would be D because of the plotted points of both pink and blue :)

Can someone help me solve this? Pls and ty!

Can someone help me solve this? Pls and ty!

Answers

Answer:

H. 95°

Step-by-step explanation:

m∠BGC is 10° smaller than m∠CGD, which means that m∠BGC is x° - 10°

m∠DGE is 25° more than m∠EGF, which means that m∠DGE is x° + 25°

The sum of all angles in a placement like this will always equal 360°

So we put all the measures of all angles on one side of thee equation and set it equal to 360*

x° + x° - 10° + 2x° + 25° + 2x° + 3x° + 30° = 360°

After combining like terms we get 9x° + 45° = 360°

After some algebra we get x = 35°

Now at the start we said that m∠DGE is x + 25°

Plug in 35° for x and we get 35° + 25°

The final answer is m∠DGE = 95°

Edit: Sorry if my answer looks a bit confusing. This is actually my first answer on Brainly so I'm quite new to this experience.

The person above is correct, give brainliest

37 POINTS PLEASE ANSWERR THANK YOU !!

37 POINTS PLEASE ANSWERR THANK YOU !!

Answers

Answer:

ehhhh, probably A, this really didn't make since for me

I think it’s the answer b

pierre, an art dealer, earns 25% commission of the dollar value of the art pieces that he sells at the bizzell Gallery. Pierre earns $10,800 this month. what is the total dollar value of the art that he sells?

Answers

Answer:

$43,200

Step-by-step explanation:

25% is 1/4 of the total dollar value, to find the answer we need to multiply 10,800 by 4 (it is 1/4, and the answer will be equivalent to the 4/4)

10,800 * 4 = 43,200

The total dollar value of the art that he sells is 43200 dollars.

What is percentage ?

Percentage is the value per hundredth.We can also convert percentages into decimals by dividing he percentage value by 100.

According to the given question Pierre, an art dealer, earns 25% commission of the dollar value of the art pieces that he sells at the Bizzell Gallery. Pierre earns $10,800.

∴ 25% of the total value is 10800 dollars.

Assuming total value to be x dollars.

So, (25/100)x = 10800

(1/4)x = 10800

x = 10800 × 4

x = 43200 dollars.

learn more about percentage here :

https://brainly.com/question/27139643

#SPJ2

A teacher selects two different numbers, x and y, and states that x + y = 0. Which statement could be true about these two numbers?

Both numbers are positive.

Both numbers are negative.

One number is zero and the other is positive.

One number is positive and the other is negative

Answers

Answer:

One number is positive, and the other is negative. The numbers are additive inverses. x + y = 0 -----> y = -x

One number is positive and the other is negative

The tape diagram below represents 100\%100%100, percent.

What percent is represented by the shaded area?

Answers

Answer:

Step-by-step explanation:

Well the answer is 40 cause you count by 20 so if you in 20 t o times then you would get 40 percent

Your answer would be 40.

Someone please help.

Someone please help.

Answers

Answer:

Because the triangle is equilateral. And it is on a straight line.

Hope that helped!

.

\(answers \\ a. \: x = 60 \\ b. \: being \: alternate \: interior \: angles \\ solution \\ all \: sides \: of \: triangle \: are \: equal \\ ab = bc = ac \\ < abc = < acb = < bac = y \\ < abc + < acb + < bac = 180 \\ or \: y + y + y = 180 \\ or \: 3y = 180 \\ or \: y = \frac{180}{3} \\ y = 60 \\ < acb = < cad \\ < cad = x = 60( \: being \: alternate \: interior \: angles) \\ hope \: it \: helps...\)

Someone please help.

a. Survey 1 is biased.
b. There is no bias.

a. Survey 1 is biased.b. There is no bias.

Answers

Answer:

yes there seems to be a bias.

who ever gets this right will get a brainlest

who ever gets this right will get a brainlest

Answers

Answer:

20%

Step-by-step explanation:

750 - 20% is 600

so it's D

The answer is 20%. ITS THE LAST ONE

One out of every 3 players on a soccer team is new this season. There are 15 player on the team in all. How many players are new?

Answers

Answer : 5 players

Step - by - step explanation :

First, put the information down . . .

1 out 3 players are new this season

there are 15 players in total

Second, convert ( the denominator [ to 15 ] ) . . .

1/3 x 5/5 = 5/15 <-- 5 players are new this season

tip : when trying to do things like this - multiply the numerator and the denominator by the same number for accurate results !

The number of new players is 5.

What is division?

Division is breaking a number up into an equal number of parts.

Given that, One out of every 3 players on a soccer team is new this season, There are 15 players on the team in all.

15/3 = 5

Hence, The number of new players is 5.

For more references on division, click;

https://brainly.com/question/21416852

#SPJ2

The figure is the net for a rectangular prism.

What is the surface area of the rectangular prism represented by the net?



Enter your answer in the box. 55 points

The figure is the net for a rectangular prism.What is the surface area of the rectangular prism represented

Answers

Answer:

174 in²

Step-by-step explanation:

Surface Area = 2(lw + hw + hl)

                      = 2((9 * 5) + (3 * 5) + (3 * 9))

                      = 2(45 + 15 + 27)

                      = 2(87)

                      = 174 in²

Answer:

174 in²

Step by step:

Surface Area = 2(lw + hw + hl)

                     = 2((9 * 5) + (3 * 5) + (3 * 9))

                     = 2(45 + 15 + 27)

                     = 2(87)

                     = 174 in²

A store sells a package of 25 trading cards for​ $5.25. What is the unit price per​ card?

Answers

The cost of one trading card obtained using the principle of proportionality is $0.21


Given the Parameters:

25 trading cards = $5.25


Let the Cost of one trading card = b


We could set up a proportional system to calculate the Cost of one trading card as
follows :

25 cards = $5.25
1 card = b


Cross multiply:

25b = $5.25


Divide both sides by 25 to isolate b



25b/25 = 5.25 / 25
b= $0.21


Therefore, one trading card costs $0.21
The numerator is smaller than the denominator what you divide 5.25 by 25 so the unit price is going to be less than 1.

The unit price is $0.21

Step-by-step explanation:

25 cards = $5.25

5.25/25 = $0.21

Jim bought 5 packs of red bouncy balls, 2 packs of yellow bouncy balls, and 7 packs of green bouncy balls. There were 7 bouncy balls in each package. How many bouncy balls did Jim buy in all?

Answers

Answer:

108 bouncy balls

Step-by-step explanation:

2*7=14

5*7=35

7*7=49

14+35+49+108

He bout 98 bouncy balls

PLEASE HURRY!!!! Which ratio is equivalent to 4, (point)
16
02:4
06 to 20
08:32
O 12 to 64

Answers

08:32 i did this on a text and it’s was right hope this helps you:)

The ratio equivalent to the ratio 4:16 is 1:4.

What is the ratio?

The ratio is defined as the comparison of two quantities of the same units that indicates how much of one quantity is present in the other quantity.

The given ratio is 4:16.

Here, 4:16 can be written as 4/16

Divide both the numerator and denominator by 4, we get

1/4

So, 1/4 can be written in ratio as 1:4

Therefore, the ratio equivalent to the ratio 4:16 is 1:4.

To learn more about the ratio visit:

brainly.com/question/13419413.

#SPJ7

can someone answer these questions for me? I have no idea how to solve any of them.

it would be best if you showed your work please

can someone answer these questions for me? I have no idea how to solve any of them.it would be best if

Answers

I am so sorry I don’t know

Binomial (x-4) and trinomial (-2x^2 + 3x + 4) are the factors of what polynomial?

Answers

The answer to that is x - 4

Elena has 32 hair ties. Melanie has 8 hair ties. The ratio of Elena’s hair ties to Melanie’s hair ties is : 1. If, Melanie gets 4 more hair ties, the new ratio of Elena’s hair ties to Melanie’s hair ties is 8 : . Helppppppp me

Answers

Answer:

4:1 & 8:2

Step-by-step explanation:

The ratio is 32/8

When simplified it will be 4/1

Since the next ratio is 8/x, make the equation 4x = 8

Because x = 2 the ratio will be 8/2

Identify the domain of the function shown in the graph

Identify the domain of the function shown in the graph

Answers

Answer: B

Step-by-step explanation:

This looks like a cosine function. Cosine can take on any x value and still be defined. That means all real numbers will work. When asked for domain, it really just means what x values are defined for this function. We just said, cosine can take any x value

If you didnt know this was a cosine function, you could just visually see the function goes on to -∞ and +∞. There's no reason for the function to run into a critical point

PLEASE HELP I WILL GIVE BRAINLIEST

PLEASE HELP I WILL GIVE BRAINLIEST

Answers

Answer:

AB//EF

LM//XY

Step-by-step explanation:

Even if the lines are extended, they are only parallel to each other, so (Ab) is a line and (EF) is parallel and LM//XM

AB/EF, LM/XY. Hope this helps.

A new bank customer with ​$3,000 wants to open a money market account. The bank is offering a simple interest rate of ​1.9%. a. How much interest will the customer earn in 30 ​years? b. What will the account balance be after 30 ​years?
pls answer fast due in 10 minutes

Answers

a. To calculate the interest earned in 30 years, we can use the simple interest formula:

Simple interest = Principal * Rate * Time

Here, the principal (P) is $3,000, the rate (R) is 1.9%, and the time (T) is 30 years.

Simple interest = $3,000 * 0.019 * 30 = $1,710

Therefore, the customer will earn $1,710 in interest over 30 years.

b. To calculate the account balance after 30 years, we can add the interest earned to the principal:

Account balance = Principal + Interest

Account balance = $3,000 + $1,710 = $4,710

Therefore, the account balance will be $4,710 after 30 years.

a. To calculate the interest earned in 30 years, we can use the simple interest formula:

Simple interest = Principal * Rate * Time

Here, the principal (P) is $3,000, the rate (R) is 1.9%, and the time (T) is 30 years.

Simple interest = $3,000 * 0.019 * 30 = $1,710

Therefore, the customer will earn $1,710 in interest over 30 years.

b. To calculate the account balance after 30 years, we can add the interest earned to the principal:

Account balance = Principal + Interest

Account balance = $3,000 + $1,710 = $4,710

Therefore, the account balance will be $4,710 after 30 years.

Other Questions
When burning methane (methane + oxygen > carbon dioxide + water, CH4+202> CO2+2H2O), what would happen if you decreased the amount of oxygen?A - more methane and oxygen will be producedB - less methane and oxygen will be producedC - more carbon dioxide and water will be producedD - less carbon dioxide and water will be produced From one run of the proposed electron transport chain, how many molecules of ATP equivalents in energy could theoretically be generated? a) 3 b) 4 c) 5 d) 6 e) 7 If the united state president doae not like a law, he can it In the country of Marzipana, total consumption in Year 1 was $56,000 million and in Year 2 was $60,000 million. It has been observed that each time disposable income changes in this country by $100, consumption changes by $70. Using this information compute the change in disposable income from Year 1 to Year 2.A. Disposable income increased by $2,800 million in Year 2.B. Disposable income decreased by $2,000 million in Year 2.C. Disposable income increased by $2,000 million in Year 2.D. Disposable income increased by $4,500 million in Year 2.E. Disposable income decreased by $2,600 million in Year 2. The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the proteins at the carboxyl sides of the amino acids lysine or arginine. The products of the digestion are then subjected to ESI TOF-MS in positive ion mode with the peptides in a pH 2 solution. a. Calculate the mass of each cleavage product based on their amino acid sequence and determine their predominant charge state at pH 2. Which product will reach the detector first 5 1/5 + 4 3/5 please help in the enabling legislation, congress may require that an agency hold a formal public hearing before promulgating any new rules in its subject matter area. when this happens, we say that congress requires this agency to use: How did Chinese contact with the outside world change during the Ming dynasty? Which ratio is different from the others? > 8 to 15 ,15:8 ,8:15 8/15 ng vit nam ra i vo nm no? Describe the structure and functions of each part of a long bone. ect the best answer for the question.- (-1) + 5 -(-6) - 5 =A. 5B. -3C. OD. -2Mark for review (will be highlighted on the review bar Two cars collide and then stick together in an accident.Car A has a mass of 1000. kg and is moving 5.00 m/s east, andcar B has a mass of 2000. kg and is moving 2.00 m/s west.What is the speed of the cars after the collision?b. 1.53m/sc. 2.43m/sa. 0.33m/sd. 3.93m/sWhats the answer on the first birthday, we light one candle; on the second birthday 2 candles; and on the 120th birthday 120 candles. how many candles do we light total in all 120 birthdays? use the proper summation formula we learned in class. Please help! Refer to the image. The phase change between white tin and gray tin is difficult to observe directly. Both substances can be burned, however. From these equations, calculate AH for the conversion of gray tin into white tin: Sn(s, white) + O2(g) + SnO2(g) AH = -580.69 kJ Sn(s, gray) + O2(g) + SnO2(g) AH = -582.78 kJ AH = _________ kJ Explain how the number line can be used to determine the sum of the location of point T and -1 1/2. most blood from the brain flows down the internal jugular veins and then into Which conclusion does this image best support? Early humans crafted stone tools. Early humans lived in patrilineal groups. Early humans had knowledge of many animals. Early humans made clothing from animal furs. Mark this and return Sav THIS IS DUE TODAY AND I NEED HELPPP THE ANSWER IN THE FIRST BOX IS AN EXAMPLE